Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMitogen-activated protein kinase 9
LigandBDBM50169959
Substrate/Competitorn/a
Meas. Tech.ChEMBL_624059
IC50 220±n/a nM
Citation Siddiqui MAReddy PA Small molecule JNK (c-Jun N-terminal kinase) inhibitors. J Med Chem 53:3005-12 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Mitogen-activated protein kinase 9
Name:JNK2/JNK3
Synonyms:JNK-55 | JNK2/JNK3 | Mitogen-Activated Protein Kinase 9 (JNK2) | Stress-activated protein kinase JNK2 | c-Jun N-terminal kinase 2 | c-Jun N-terminal kinase 2 (JNK2)
Type:Enzyme
Mol. Mass.:48131.49
Organism:Homo sapiens (Human)
Description:JNK-2 was purchased from Upstate Cell Signaling Solutions (formerly Upstate Biotechnology).
Residue:424
Sequence:
MSDSKCDSQFYSVQVADSTFTVLKRYQQLKPIGSGAQGIVCAAFDTVLGINVAVKKLSRP
FQNQTHAKRAYRELVLLKCVNHKNIISLLNVFTPQKTLEEFQDVYLVMELMDANLCQVIH
MELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTACTNF
MMTPYVVTRYYRAPEVILGMGYKENVDIWSVGCIMGELVKGCVIFQGTDHIDQWNKVIEQ
LGTPSAEFMKKLQPTVRNYVENRPKYPGIKFEELFPDWIFPSESERDKIKTSQARDLLSK
MLVIDPDKRISVDEALRHPYITVWYDPAEAEAPPPQIYDAQLEEREHAIEEWKELIYKEV
MDWEERSKNGVVKDQPSDAAVSSNATPSQSSSINDISSMSTEQTLASDTDSSLDASTGPL
EGCR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50169959
n/a
NameBDBM50169959
Synonyms:2-(benzo[d]thiazol-2(3H)-ylidene)-2-(2-(2-(pyridin-3-yl)ethylamino)pyrimidin-4-yl)acetonitrile | AS-601245 | AS601245 | CHEMBL1788116 | CHEMBL191384 | [3H-Benzothiazol-(2Z)-ylidene]-[2-(2-pyridin-3-yl-ethylamino)-pyrimidin-4-yl]-acetonitrile
TypeSmall organic molecule
Emp. Form.C20H16N6S
Mol. Mass.372.446
SMILESN#CC(c1nc2ccccc2s1)c1ccnc(NCCc2cccnc2)n1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: