| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Mitogen-activated protein kinase 1 |
|---|
| Ligand | BDBM50314344 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_624535 (CHEMBL1110584) |
|---|
| IC50 | 50±n/a nM |
|---|
| Citation |  Tsou, HR; MacEwan, G; Birnberg, G; Grosu, G; Bursavich, MG; Bard, J; Brooijmans, N; Toral-Barza, L; Hollander, I; Mansour, TS; Ayral-Kaloustian, S; Yu, K Discovery and optimization of 2-(4-substituted-pyrrolo[2,3-b]pyridin-3-yl)methylene-4-hydroxybenzofuran-3(2H)-ones as potent and selective ATP-competitive inhibitors of the mammalian target of rapamycin (mTOR). Bioorg Med Chem Lett20:2321-5 (2010) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Mitogen-activated protein kinase 1 |
|---|
| Name: | Mitogen-activated protein kinase 1 |
|---|
| Synonyms: | ERK2 | ERT1 | Extracellular signal-regulated kinase 2 | Extracellular signal-regulated kinase 2 (ERK-2) | Extracellular signal-regulated kinase 2 (ERK2) | MAP Kinase 2/ERK2 | MAPK 2 | MAPK1 | MK01_HUMAN | Mitogen activated kinase 1 (ERK-2) | Mitogen-activated protein kinase 1 (ERK-2) | Mitogen-activated protein kinase 1 (ERK2) | Mitogen-activated protein kinase 2 | PRKM1 | PRKM2 | p42-MAPK |
|---|
| Type: | Ser/Thr Protein Kinase |
|---|
| Mol. Mass.: | 41392.76 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P28482 |
|---|
| Residue: | 360 |
|---|
| Sequence: | MAAAAAAGAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKISPFE
HQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQH
LSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDH
TGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHI
LGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHK
RIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS
|
|
|
|---|
| BDBM50314344 |
|---|
| n/a |
|---|
| Name | BDBM50314344 |
|---|
| Synonyms: | 4-(3-((4-hydroxy-3-oxobenzofuran-2(3H)-ylidene)methyl)-1-methyl-1H-pyrrolo[2,3-b]pyridin-4-yl)-N-(2-hydroxyethyl)benzamide | CHEMBL1092754 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C26H21N3O5 |
|---|
| Mol. Mass. | 455.462 |
|---|
| SMILES | Cn1cc(\C=C2/Oc3cccc(O)c3C2=O)c2c(ccnc12)-c1ccc(cc1)C(=O)NCCO |
|---|
| Structure | 
|
|---|
Search and Browse
