Reaction Details |
| Report a problem with these data |
Target | Sphingosine 1-phosphate receptor 4 |
---|
Ligand | BDBM50314402 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_624585 (CHEMBL1111545) |
---|
EC50 | 15.98±n/a nM |
---|
Citation | Ma, B; Guckian, KM; Lin, EY; Lee, WC; Scott, D; Kumaravel, G; Macdonald, TL; Lynch, KR; Black, C; Chollate, S; Hahm, K; Hetu, G; Jin, P; Luo, Y; Rohde, E; Rossomando, A; Scannevin, R; Wang, J; Yang, C Stereochemistry-activity relationship of orally active tetralin S1P agonist prodrugs. Bioorg Med Chem Lett20:2264-9 (2010) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Sphingosine 1-phosphate receptor 4 |
---|
Name: | Sphingosine 1-phosphate receptor 4 |
Synonyms: | EDG6 | Endothelial differentiation G-protein coupled receptor 6 | S1P receptor 4 | S1P receptor Edg-6 | S1P4 | S1PR4 | S1PR4_HUMAN | Sphingosine 1-phosphate receptor | Sphingosine 1-phosphate receptor Edg-6 | Sphingosine-1-phosphate receptor 4 | sphingosine-1-phosphate 4 S1P4 |
Type: | G Protein-Coupled Receptor (GPCR) |
Mol. Mass.: | 41647.39 |
Organism: | Homo sapiens (Human) |
Description: | n/a |
Residue: | 384 |
Sequence: | MNATGTPVAPESCQQLAAGGHSRLIVLHYNHSGRLAGRGGPEDGGLGALRGLSVAASCLV
VLENLLVLAAITSHMRSRRWVYYCLVNITLSDLLTGAAYLANVLLSGARTFRLAPAQWFL
REGLLFTALAASTFSLLFTAGERFATMVRPVAESGATKTSRVYGFIGLCWLLAALLGMLP
LLGWNCLCAFDRCSSLLPLYSKRYILFCLVIFAGVLATIMGLYGAIFRLVQASGQKAPRP
AARRKARRLLKTVLMILLAFLVCWGPLFGLLLADVFGSNLWAQEYLRGMDWILALAVLNS
AVNPIIYSFRSREVCRAVLSFLCCGCLRLGMRGPGDCLARAVEAHSGASTTDSSLRPRDS
FRGSRSLSFRMREPLSSISSVRSI
|
|
|
BDBM50314402 |
---|
n/a |
---|
Name | BDBM50314402 |
Synonyms: | (R)-2-amino-2-((S)-6-octyl-1,2,3,4-tetrahydronaphthalen-2-yl)propyl dihydrogen phosphate | CHEMBL1093686 |
Type | Small organic molecule |
Emp. Form. | C21H36NO4P |
Mol. Mass. | 397.4886 |
SMILES | CCCCCCCCc1ccc2C[C@H](CCc2c1)[C@@](C)(N)COP(O)(O)=O |r| |
Structure |
|