Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetOxytocin receptor
LigandBDBM50314522
Substrate/Competitorn/a
Meas. Tech.ChEMBL_624611
Ki 48±n/a nM
Citation Brown AEllis DWallace ORalph M Identification of amide bioisosteres of triazole oxytocin antagonists. Bioorg Med Chem Lett 20:2224-8 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Oxytocin receptor
Name:Oxytocin receptor
Synonyms:OT-R | Oxytocin
Type:Enzyme Catalytic Domain
Mol. Mass.:42793.26
Organism:HEK293
Description:Oxytocin OXTR HEK293::B2R9L7
Residue:389
Sequence:
MEGALAANWSAEAANASAAPPGAEGNRTAGPPRRNEALARVEVAVLCLILLLALSGNACV
LLALRTTRQKHSRLFFFMKHLSIADLVVAVFQVLPQLLWDITFRFYGPDLLCRLVKYLQV
VGMFASTYLLLLMSLDRCLAICQPLRSLRRRTDRLAVLATWLGCLVASAPQVHIFSLREV
ADGVFDCWAVFIQPWGPKAYITWITLAVYIVPVIVLAACYGLISFKIWQNLRLKTAAAAA
AEAPEGAAAGDGGRVALARVSSVKLISKAKIRTVKMTFIIVLAFIVCWTPFFFVQMWSVW
DANAPKEASAFIIVMLLASLNSCCNPWIYMLFTGHLFHELVQRFLCCSASYLKGRRLGET
SASKKSNSSSFVLSHRSSSQRSCSQPSTA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50314522
n/a
NameBDBM50314522
Synonyms:CHEMBL1089272 | N-ethyl-N-(6-methoxypyridin-3-yl)-2-(naphthalen-2-yloxy)acetamide
TypeSmall organic molecule
Emp. Form.C20H20N2O3
Mol. Mass.336.3844
SMILESCCN(C(=O)COc1ccc2ccccc2c1)c1ccc(OC)nc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: