Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetcAMP-specific 3',5'-cyclic phosphodiesterase 4D
LigandBDBM50314578
Substrate/Competitorn/a
Meas. Tech.ChEMBL_625098
Ki 11500±n/a nM
Citation Donnell AFDollings PJButera JADietrich AJLipinski KKGhavami AHirst WD Identification of pyridazino[4,5-b]indolizines as selective PDE4B inhibitors. Bioorg Med Chem Lett 20:2163-7 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
cAMP-specific 3',5'-cyclic phosphodiesterase 4D
Name:cAMP-specific 3',5'-cyclic phosphodiesterase 4D
Synonyms:DPDE3 | PDE43 | PDE4D | Phosphodiesterase 4D
Type:Protein
Mol. Mass.:91092.69
Organism:Homo sapiens (Human)
Description:Q08499
Residue:809
Sequence:
MEAEGSSAPARAGSGEGSDSAGGATLKAPKHLWRHEQHHQYPLRQPQFRLLHPHHHLPPP
PPPSPQPQPQCPLQPPPPPPLPPPPPPPGAARGRYASSGATGRVRHRGYSDTERYLYCRA
MDRTSYAVETGHRPGLKKSRMSWPSSFQGLRRFDVDNGTSAGRSPLDPMTSPGSGLILQA
NFVHSQRRESFLYRSDSDYDLSPKSMSRNSSIASDIHGDDLIVTPFAQVLASLRTVRNNF
AALTNLQDRAPSKRSPMCNQPSINKATITEEAYQKLASETLEELDWCLDQLETLQTRHSV
SEMASNKFKRMLNRELTHLSEMSRSGNQVSEFISNTFLDKQHEVEIPSPTQKEKEKKKRP
MSQISGVKKLMHSSSLTNSSIPRFGVKTEQEDVLAKELEDVNKWGLHVFRIAELSGNRPL
TVIMHTIFQERDLLKTFKIPVDTLITYLMTLEDHYHADVAYHNNIHAADVVQSTHVLLST
PALEAVFTDLEILAAIFASAIHDVDHPGVSNQFLINTNSELALMYNDSSVLENHHLAVGF
KLLQEENCDIFQNLTKKQRQSLRKMVIDIVLATDMSKHMNLLADLKTMVETKKVTSSGVL
LLDNYSDRIQVLQNMVHCADLSNPTKPLQLYRQWTDRIMEEFFRQGDRERERGMEISPMC
DKHNASVEKSQVGFIDYIVHPLWETWADLVHPDAQDILDTLEDNREWYQSTIPQSPSPAP
DDPEEGRQGQTEKFQFELTLEEDGESDTEKDSGSQVEEDTSCSDSKTLCTQDSESTEIPL
DEQVEEEAVGEEEESQPEACVIDDRSPDT
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50314578
n/a
NameBDBM50314578
Synonyms:(4-(3-(1,2-dimethyl-7-(3-nitrophenyl)-1H-pyrrolo[3,2-d]pyridazin-4-ylamino)propyl)piperazin-1-yl)(pyridin-2-yl)methanone | CHEMBL1091447
TypeSmall organic molecule
Emp. Form.C27H30N8O3
Mol. Mass.514.5789
SMILESCc1cc2c(NCCCN3CCN(CC3)C(=O)c3ccccn3)nnc(-c3cccc(c3)[N+]([O-])=O)c2n1C
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: