Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetRenin
LigandBDBM50314648
Substrate/Competitorn/a
Meas. Tech.ChEMBL_625596
pH7.4±n/a
IC50 0.19±n/a nM
Commentsextracted
Citation Chen ABayly CBezençon ORichard-Bildstein SDubé DDubé LGagné SGallant MGaudreault MGrimm EHoule RLacombe PLaliberté SLévesque JFLiu SMacDonald DMackay BMartin DMcKay DPowell DRemen LSoisson SToulmond S Design and optimization of a substituted amino propanamide series of renin inhibitors for the treatment of hypertension. Bioorg Med Chem Lett 20:2204-9 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Renin
Name:Renin
Synonyms:Angiotensinogenase
Type:Enzyme
Mol. Mass.:45058.99
Organism:Homo sapiens (Human)
Description:n/a
Residue:406
Sequence:
MDGWRRMPRWGLLLLLWGSCTFGLPTDTTTFKRIFLKRMPSIRESLKERGVDMARLGPEW
SQPMKRLTLGNTTSSVILTNYMDTQYYGEIGIGTPPQTFKVVFDTGSSNVWVPSSKCSRL
YTACVYHKLFDASDSSSYKHNGTELTLRYSTGTVSGFLSQDIITVGGITVTQMFGEVTEM
PALPFMLAEFDGVVGMGFIEQAIGRVTPIFDNIISQGVLKEDVFSFYYNRDSENSQSLGG
QIVLGGSDPQHYEGNFHYINLIKTGVWQIQMKGVSVGSSTLLCEDGCLALVDTGASYISG
STSSIEKLMEALGAKKRLFDYVVKCNEGPTLPDISFHLGGKEYTLTSADYVFQESYSSKK
LCTLAIHAMDIPPPTGPTWALGATFIRKFYTEFDRRNNRIGFALAR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50314648
n/a
NameBDBM50314648
Synonyms:3-amino-N-(2-chloro-5-(2-methoxyethyl)benzyl)-N-cyclopropyl-2-(4-(3-(2,6-dichloro-4-methylphenoxy)propyl)benzyl)propanamide | CHEMBL1092187
TypeSmall organic molecule
Emp. Form.C33H39Cl3N2O3
Mol. Mass.618.033
SMILESCOCCc1ccc(Cl)c(CN(C2CC2)C(=O)C(CN)Cc2ccc(CCCOc3c(Cl)cc(C)cc3Cl)cc2)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: