| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1 |
|---|
| Ligand | BDBM50314685 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_625852 (CHEMBL1109788) |
|---|
| Ki | 2000±n/a nM |
|---|
| Citation |  Dong, L; Marakovits, J; Hou, X; Guo, C; Greasley, S; Dagostino, E; Ferre, R; Johnson, MC; Kraynov, E; Thomson, J; Pathak, V; Murray, BW Structure-based design of novel human Pin1 inhibitors (II). Bioorg Med Chem Lett20:2210-4 (2010) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1 |
|---|
| Name: | Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1 |
|---|
| Synonyms: | PIN1 | PIN1_HUMAN | PPIase Pin1 | Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1 |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 18248.11 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | ChEMBL_1502595 |
|---|
| Residue: | 163 |
|---|
| Sequence: | MADEEKLPPGWEKRMSRSSGRVYYFNHITNASQWERPSGNSSSGGKNGQGEPARVRCSHL
LVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARG
DLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
|
|
|
|---|
| BDBM50314685 |
|---|
| n/a |
|---|
| Name | BDBM50314685 |
|---|
| Synonyms: | (R)-3-(2-naphthamido)-4-(3-chlorophenyl)butanoic acid | CHEMBL1089685 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C21H18ClNO3 |
|---|
| Mol. Mass. | 367.826 |
|---|
| SMILES | OC(=O)C[C@@H](Cc1cccc(Cl)c1)NC(=O)c1ccc2ccccc2c1 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
