| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Cathepsin D |
|---|
| Ligand | BDBM50315003 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_624430 (CHEMBL1108758) |
|---|
| IC50 | 43600±n/a nM |
|---|
| Citation |  Malamas, MS; Barnes, K; Hui, Y; Johnson, M; Lovering, F; Condon, J; Fobare, W; Solvibile, W; Turner, J; Hu, Y; Manas, ES; Fan, K; Olland, A; Chopra, R; Bard, J; Pangalos, MN; Reinhart, P; Robichaud, AJ Novel pyrrolyl 2-aminopyridines as potent and selective human beta-secretase (BACE1) inhibitors. Bioorg Med Chem Lett20:2068-73 (2010) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Cathepsin D |
|---|
| Name: | Cathepsin D |
|---|
| Synonyms: | CATD_HUMAN | CPSD | CTSD | Cathepsin D [Precursor] | Cathepsin D heavy chain | Cathepsin D light chain | Cathepsin D precursor |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 44551.72 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Human proCathepsin D (SwissProt accession number P07339) was expressed in Sf9 cells, purified, and autoactivated. |
|---|
| Residue: | 412 |
|---|
| Sequence: | MQPSSLLPLALCLLAAPASALVRIPLHKFTSIRRTMSEVGGSVEDLIAKGPVSKYSQAVP
AVTEGPIPEVLKNYMDAQYYGEIGIGTPPQCFTVVFDTGSSNLWVPSIHCKLLDIACWIH
HKYNSDKSSTYVKNGTSFDIHYGSGSLSGYLSQDTVSVPCQSASSASALGGVKVERQVFG
EATKQPGITFIAAKFDGILGMAYPRISVNNVLPVFDNLMQQKLVDQNIFSFYLSRDPDAQ
PGGELMLGGTDSKYYKGSLSYLNVTRKAYWQVHLDQVEVASGLTLCKEGCEAIVDTGTSL
MVGPVDEVRELQKAIGAVPLIQGEYMIPCEKVSTLPAITLKLGGKGYKLSPEDYTLKVSQ
AGKTLCLSGFMGMDIPPPSGPLWILGDVFIGRYYTVFDRDNNRVGFAEAARL
|
|
|
|---|
| BDBM50315003 |
|---|
| n/a |
|---|
| Name | BDBM50315003 |
|---|
| Synonyms: | CHEMBL1092227 | N-allyl-4-(1-((6-aminopyridin-2-yl)methyl)-5-phenyl-1H-pyrrol-2-yl)benzamide |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C26H24N4O |
|---|
| Mol. Mass. | 408.495 |
|---|
| SMILES | Nc1cccc(Cn2c(ccc2-c2ccc(cc2)C(=O)NCC=C)-c2ccccc2)n1 |
|---|
| Structure | 
|
|---|
Search and Browse
