Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetC-C chemokine receptor type 1
LigandBDBM50315303
Substrate/Competitorn/a
Meas. Tech.ChEMBL_626228
IC50>10000±n/a nM
Citation Skerlj RTBridger GJKaller AMcEachern EJCrawford JBZhou YAtsma BLangille JNan SVeale DWilson THarwig CHatse SPrincen KDe Clercq ESchols D Discovery of novel small molecule orally bioavailable C-X-C chemokine receptor 4 antagonists that are potent inhibitors of T-tropic (X4) HIV-1 replication. J Med Chem 53:3376-88 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
C-C chemokine receptor type 1
Name:C-C chemokine receptor type 1
Synonyms:C-C CKR-1 | C-C chemokine receptor type 1 (CCR1) | CC-CKR-1 | CCR-1 | CCR1 | CD_antigen=CD191 | HM145 | LD78 receptor | MIP-1alpha-R | Macrophage inflammatory protein 1-alpha receptor | RANTES-R
Type:Enzyme
Mol. Mass.:41180.69
Organism:Homo sapiens (Human)
Description:P32246
Residue:355
Sequence:
METPNTTEDYDTTTEFDYGDATPCQKVNERAFGAQLLPPLYSLVFVIGLVGNILVVLVLV
QYKRLKNMTSIYLLNLAISDLLFLFTLPFWIDYKLKDDWVFGDAMCKILSGFYYTGLYSE
IFFIILLTIDRYLAIVHAVFALRARTVTFGVITSIIIWALAILASMPGLYFSKTQWEFTH
HTCSLHFPHESLREWKLFQALKLNLFGLVLPLLVMIICYTGIIKILLRRPNEKKSKAVRL
IFVIMIIFFLFWTPYNLTILISVFQDFLFTHECEQSRHLDLAVQVTEVIAYTHCCVNPVI
YAFVGERFRKYLRQLFHRRVAVHLVKWLPFLSVDRLERVSSTSPSTGEHELSAGF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50315303
n/a
NameBDBM50315303
Synonyms:(S)-N-(2-Pyridinylmethyl)-N'-(1H-benzimidazol-2-ylmethyl)-N'-(5,6,7,8-tetrahydro-8-quinolinyl)-1,4-benzenedimethanamine | CHEMBL1093137
TypeSmall organic molecule
Emp. Form.C31H32N6
Mol. Mass.488.626
SMILESC(NCc1ccccn1)c1ccc(CN(Cc2nc3ccccc3[nH]2)[C@H]2CCCc3cccnc23)cc1 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: