Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetC-C chemokine receptor type 4 (CCR4)
LigandBDBM50315305
Substrate/Competitorn/a
Meas. Tech.ChEMBL_626226
IC50>10000±n/a nM
Citation Skerlj RTBridger GJKaller AMcEachern EJCrawford JBZhou YAtsma BLangille JNan SVeale DWilson THarwig CHatse SPrincen KDe Clercq ESchols D Discovery of novel small molecule orally bioavailable C-X-C chemokine receptor 4 antagonists that are potent inhibitors of T-tropic (X4) HIV-1 replication. J Med Chem 53:3376-88 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
C-C chemokine receptor type 4 (CCR4)
Name:C-C chemokine receptor type 4
Synonyms:C-C CKR-4 | C-C chemokine receptor type 4 | CC-CKR-4 | CCR-4 | CCR4 | CD_antigen=CD194 | K5-5
Type:Enzyme
Mol. Mass.:41406.41
Organism:Homo sapiens (Human)
Description:P51679
Residue:360
Sequence:
MNPTDIADTTLDESIYSNYYLYESIPKPCTKEGIKAFGELFLPPLYSLVFVFGLLGNSVV
VLVLFKYKRLRSMTDVYLLNLAISDLLFVFSLPFWGYYAADQWVFGLGLCKMISWMYLVG
FYSGIFFVMLMSIDRYLAIVHAVFSLRARTLTYGVITSLATWSVAVFASLPGFLFSTCYT
ERNHTYCKTKYSLNSTTWKVLSSLEINILGLVIPLGIMLFCYSMIIRTLQHCKNEKKNKA
VKMIFAVVVLFLGFWTPYNIVLFLETLVELEVLQDCTFERYLDYAIQATETLAFVHCCLN
PIIYFFLGEKFRKYILQLFKTCRGLFVLCQYCGLLQIYSADTPSSSYTQSTMDHDLHDAL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50315305
n/a
NameBDBM50315305
Synonyms:(S)-N-((1H-benzo[d]imidazol-2-yl)methyl)-N-(4-aminobutyl)-5,6,7,8-tetrahydroquinolin-8-amine | (S)-N1-((1H-benzo[d]imidazol-2-yl)methyl)-N1-(5,6,7,8-tetrahydroquinolin-8-yl)butane-1,4-diamine | CHEMBL518924
TypeSmall organic molecule
Emp. Form.C21H27N5
Mol. Mass.349.4726
SMILESNCCCCN(Cc1nc2ccccc2[nH]1)[C@H]1CCCc2cccnc12 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: