Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCalcitonin gene-related peptide type 1 receptor
LigandBDBM50315409
Substrate/Competitorn/a
Meas. Tech.ChEMBL_626017
Ki 0.072±n/a nM
Citation Stump CABell IMBednar RAFay JFGallicchio SNHershey JCJelley RKreatsoulas CMoore ELMosser SDQuigley AGRoller SASalvatore CASharik SSTheberge CRZartman CBKane SAGraham SLSelnick HGVacca JPWilliams TM Identification of potent, highly constrained CGRP receptor antagonists. Bioorg Med Chem Lett 20:2572-6 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Calcitonin gene-related peptide type 1 receptor
Name:Adrenomedullin receptor AM1; CALCRL/RAMP2
Synonyms:Calcitonin gene-related peptide (CGRP) receptor | Calcitonin gene-related peptide 1 (CGRP) | Calcitonin receptor-like receptor
Type:Enzyme
Mol. Mass.:52931.38
Organism:Homo sapiens (Human)
Description:Q16602
Residue:461
Sequence:
MEKKCTLNFLVLLPFFMILVTAELEESPEDSIQLGVTRNKIMTAQYECYQKIMQDPIQQA
EGVYCNRTWDGWLCWNDVAAGTESMQLCPDYFQDFDPSEKVTKICDQDGNWFRHPASNRT
WTNYTQCNVNTHEKVKTALNLFYLTIIGHGLSIASLLISLGIFFYFKSLSCQRITLHKNL
FFSFVCNSVVTIIHLTAVANNQALVATNPVSCKVSQFIHLYLMGCNYFWMLCEGIYLHTL
IVVAVFAEKQHLMWYYFLGWGFPLIPACIHAIARSLYYNDNCWISSDTHLLYIIHGPICA
ALLVNLFFLLNIVRVLITKLKVTHQAESNLYMKAVRATLILVPLLGIEFVLIPWRPEGKI
AEEVYDYIMHILMHFQGLLVSTIFCFFNGEVQAILRRNWNQYKIQFGNSFSNSEALRSAS
YTVSTISDGPGYSHDCPSEHLNGKSIHDIENVLLKPENLYN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50315409
n/a
NameBDBM50315409
Synonyms:2a-ethyl-1-(((R)-2'-oxo-1',2',6,8-tetrahydrospiro[cyclopenta[g]quinoline-7,3'-pyrrolo[2,3-b]pyridine]-2-yl)methyl)-1,2,2a,3-tetrahydropyrrolo[4,3,2-de]quinolin-4(5H)-one | CHEMBL1092208
TypeSmall organic molecule
Emp. Form.C31H27N5O2
Mol. Mass.501.5784
SMILESCCC12CN(Cc3ccc4cc5C[C@]6(Cc5cc4n3)C(=O)Nc3ncccc63)c3cccc(NC(=O)C1)c23 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: