Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSodium/glucose cotransporter 1 (SGLT1)
LigandBDBM50315426
Substrate/Competitorn/a
Meas. Tech.ChEMBL_626548
IC50 3990±n/a nM
Citation Kakinuma HOi THashimoto-Tsuchiya YArai MKawakita YFukasawa YIida IHagima NTakeuchi HChino YAsami JOkumura-Kitajima LIo FYamamoto DMiyata NTakahashi TUchida SYamamoto K (1S)-1,5-anhydro-1-[5-(4-ethoxybenzyl)-2-methoxy-4-methylphenyl]-1-thio-D-glucitol (TS-071) is a potent, selective sodium-dependent glucose cotransporter 2 (SGLT2) inhibitor for type 2 diabetes treatment. J Med Chem 53:3247-61 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Sodium/glucose cotransporter 1 (SGLT1)
Name:Sodium/glucose cotransporter 1 (SGLT1)
Synonyms:High affinity sodium-glucose cotransporter | Na(+)/glucose cotransporter 1 | Sodium-Dependent Glucose Cotransporter 1 (SGLT1) | Sodium-dependent glucose cotransporter 1 (SGLT1) | Solute carrier family 5 member 1
Type:Protein
Mol. Mass.:73503.78
Organism:Homo sapiens (Human)
Description:P13866
Residue:664
Sequence:
MDSSTWSPKTTAVTRPVETHELIRNAADISIIVIYFVVVMAVGLWAMFSTNRGTVGGFFL
AGRSMVWWPIGASLFASNIGSGHFVGLAGTGAASGIAIGGFEWNALVLVVVLGWLFVPIY
IKAGVVTMPEYLRKRFGGQRIQVYLSLLSLLLYIFTKISADIFSGAIFINLALGLNLYLA
IFLLLAITALYTITGGLAAVIYTDTLQTVIMLVGSLILTGFAFHEVGGYDAFMEKYMKAI
PTIVSDGNTTFQEKCYTPRADSFHIFRDPLTGDLPWPGFIFGMSILTLWYWCTDQVIVQR
CLSAKNMSHVKGGCILCGYLKLMPMFIMVMPGMISRILYTEKIACVVPSECEKYCGTKVG
CTNIAYPTLVVELMPNGLRGLMLSVMLASLMSSLTSIFNSASTLFTMDIYAKVRKRASEK
ELMIAGRLFILVLIGISIAWVPIVQSAQSGQLFDYIQSITSYLGPPIAAVFLLAIFWKRV
NEPGAFWGLILGLLIGISRMITEFAYGTGSCMEPSNCPTIICGVHYLYFAIILFAISFIT
IVVISLLTKPIPDVHLYRLCWSLRNSKEERIDLDAEEENIQEGPKETIEIETQVPEKKKG
IFRRAYDLFCGLEQHGAPKMTEEEEKAMKMKMTDTSEKPLWRTVLNVNGIILVTVAVFCH
AYFA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50315426
n/a
NameBDBM50315426
Synonyms:(1S)-1,5-Anhydro-1-[5-(4-ethoxybenzyl)-2-methoxy-4-methylphenyl]-1-thio-D-glucitol | CHEMBL1093423
TypeSmall organic molecule
Emp. Form.C23H30O6S
Mol. Mass.434.546
SMILESCCOc1ccc(Cc2cc([C@@H]3S[C@H](CO)[C@@H](O)[C@H](O)[C@H]3O)c(OC)cc2C)cc1 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: