Reaction Details |
| Report a problem with these data |
Target | Prostaglandin E2 receptor EP2 subtype |
---|
Ligand | BDBM50315467 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_626795 (CHEMBL1107242) |
---|
IC50 | >20000±n/a nM |
---|
Citation | Zhou, N; Polozov, AM; O'Connell, M; Burgeson, J; Yu, P; Zeller, W; Zhang, J; Onua, E; Ramirez, J; Palsdottir, GA; Halldorsdottir, GV; Andresson, T; Kiselyov, AS; Gurney, M; Singh, J 1,7-Disubstituted oxyindoles are potent and selective EP(3) receptor antagonists. Bioorg Med Chem Lett20:2658-64 (2010) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Prostaglandin E2 receptor EP2 subtype |
---|
Name: | Prostaglandin E2 receptor EP2 subtype |
Synonyms: | PE2R2_HUMAN | PGE receptor EP2 subtype | PTGER2 | Prostaglandin E2 | Prostaglandin E2 receptor | Prostaglandin E2 receptor EP4 subtype | Prostanoid EP2 Receptor |
Type: | Enzyme |
Mol. Mass.: | 39775.71 |
Organism: | Homo sapiens (Human) |
Description: | P43116 |
Residue: | 358 |
Sequence: | MGNASNDSQSEDCETRQWLPPGESPAISSVMFSAGVLGNLIALALLARRWRGDVGCSAGR
RSSLSLFHVLVTELVFTDLLGTCLISPVVLASYARNQTLVALAPESRACTYFAFAMTFFS
LATMLMLFAMALERYLSIGHPYFYQRRVSRSGGLAVLPVIYAVSLLFCSLPLLDYGQYVQ
YCPGTWCFIRHGRTAYLQLYATLLLLLIVSVLACNFSVILNLIRMHRRSRRSRCGPSLGS
GRGGPGARRRGERVSMAEETDHLILLAIMTITFAVCSLPFTIFAYMNETSSRKEKWDLQA
LRFLSINSIIDPWVFAILRPPVLRLMRSVLCCRISLRTQDATQTSCSTQSDASKQADL
|
|
|
BDBM50315467 |
---|
n/a |
---|
Name | BDBM50315467 |
Synonyms: | CHEMBL1093791 | N-(4-fluorophenylsulfonyl)-3-(3-hydroxy-1-(naphthalen-2-ylmethyl)-2-oxoindolin-7-yl)acrylamide |
Type | Small organic molecule |
Emp. Form. | C28H21FN2O5S |
Mol. Mass. | 516.54 |
SMILES | OC1C(=O)N(Cc2ccc3ccccc3c2)c2c1cccc2\C=C\C(=O)NS(=O)(=O)c1ccc(F)cc1 |
Structure |
|