Reaction Details |
| Report a problem with these data |
Target | Serine/threonine-protein kinase pim-2 |
---|
Ligand | BDBM50315888 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_625012 (CHEMBL1109680) |
---|
IC50 | >1000±n/a nM |
---|
Citation | Fidanze, SD; Erickson, SA; Wang, GT; Mantei, R; Clark, RF; Sorensen, BK; Bamaung, NY; Kovar, P; Johnson, EF; Swinger, KK; Stewart, KD; Zhang, Q; Tucker, LA; Pappano, WN; Wilsbacher, JL; Wang, J; Sheppard, GS; Bell, RL; Davidsen, SK; Hubbard, RD Imidazo[2,1-b]thiazoles: multitargeted inhibitors of both the insulin-like growth factor receptor and members of the epidermal growth factor family of receptor tyrosine kinases. Bioorg Med Chem Lett20:2452-5 (2010) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Serine/threonine-protein kinase pim-2 |
---|
Name: | Serine/threonine-protein kinase pim-2 |
Synonyms: | PIM2 | PIM2_HUMAN | Pim-2h | Serine/threonine-protein kinase (PIM2) | Serine/threonine-protein kinase PIM | Serine/threonine-protein kinase pim-2 (PIM2) |
Type: | Serine/threonine-protein kinase |
Mol. Mass.: | 34185.93 |
Organism: | Homo sapiens (Human) |
Description: | Q9P1W9 |
Residue: | 311 |
Sequence: | MLTKPLQGPPAPPGTPTPPPGGKDREAFEAEYRLGPLLGKGGFGTVFAGHRLTDRLQVAI
KVIPRNRVLGWSPLSDSVTCPLEVALLWKVGAGGGHPGVIRLLDWFETQEGFMLVLERPL
PAQDLFDYITEKGPLGEGPSRCFFGQVVAAIQHCHSRGVVHRDIKDENILIDLRRGCAKL
IDFGSGALLHDEPYTDFDGTRVYSPPEWISRHQYHALPATVWSLGILLYDMVCGDIPFER
DQEILEAELHFPAHVSPDCCALIRRCLAPKPSSRPSLEEILLDPWMQTPAEDVPLNPSKG
GPAPLAWSLLP
|
|
|
BDBM50315888 |
---|
n/a |
---|
Name | BDBM50315888 |
Synonyms: | CHEMBL1090360 | N-(3-(5-(2-(3-morpholinophenylamino)pyrimidin-4-yl)imidazo[2,1-b]thiazol-6-yl)phenyl)-2-phenylacetamide |
Type | Small organic molecule |
Emp. Form. | C33H29N7O2S |
Mol. Mass. | 587.694 |
SMILES | O=C(Cc1ccccc1)Nc1cccc(c1)-c1nc2sccn2c1-c1ccnc(Nc2cccc(c2)N2CCOCC2)n1 |
Structure |
|