Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMitogen-activated protein kinase 2
LigandBDBM50316253
Substrate/Competitorn/a
Meas. Tech.ChEMBL_628519
IC50>50000±n/a nM
Citation Verheijen JCRichard DJCurran KKaplan JLefever MNowak PMalwitz DJBrooijmans NToral-Barza LZhang WGLucas JHollander IAyral-Kaloustian SMansour TSYu KZask A Discovery of 4-morpholino-6-aryl-1H-pyrazolo[3,4-d]pyrimidines as highly potent and selective ATP-competitive inhibitors of the mammalian target of rapamycin (mTOR): optimization of the 6-aryl substituent. J Med Chem 52:8010-24 (2009) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Mitogen-activated protein kinase 2
Name:Mitogen-activated protein kinase 2
Synonyms:2.7.11.1 | B lymphocyte serine/threonine-protein kinase | GC kinase | GCK | GCK | Germinal center kinase | MAP4K2 | MAPK/ERK kinase kinase kinase 2 | MEK kinase kinase 2 | MEKKK 2 | Mitogen-activated protein kinase kinase kinase kinase 2 | RAB8IP | Rab8-interacting protein
Type:n/a
Mol. Mass.:91551.35
Organism:Homo sapiens (Human)
Description:n/a
Residue:820
Sequence:
MALLRDVSLQDPRDRFELLQRVGAGTYGDVYKARDTVTSELAAVKIVKLDPGDDISSLQQ
EITILRECRHPNVVAYIGSYLRNDRLWICMEFCGGGSLQEIYHATGPLEERQIAYVCREA
LKGLHHLHSQGKIHRDIKGANLLLTLQGDVKLADFGVSGELTASVAKRRSFIGTPYWMAP
EVAAVERKGGYNELCDVWALGITAIELGELQPPLFHLHPMRALMLMSKSSFQPPKLRDKT
RWTQNFHHFLKLALTKNPKKRPTAEKLLQHPFTTQQLPRALLTQLLDKASDPHLGTPSPE
DCELETYDMFPDTIHSRGQHGPAERTPSEIQFHQVKFGAPRRKETDPLNEPWEEEWTLLG
KEELSGSLLQSVQEALEERSLTIRSASEFQELDSPDDTMGTIKRAPFLGPLPTDPPAEEP
LSSPPGTLPPPPSGPNSSPLLPTAWATMKQREDPERSSCHGLPPTPKVHMGACFSKVFNG
CPLRIHAAVTWIHPVTRDQFLVVGAEEGIYTLNLHELHEDTLEKLISHRCSWLYCVNNVL
LSLSGKSTHIWAHDLPGLFEQRRLQQQVPLSIPTNRLTQRIIPRRFALSTKIPDTKGCLQ
CRVVRNPYTGATFLLAALPTSLLLLQWYEPLQKFLLLKNFSSPLPSPAGMLEPLVLDGKE
LPQVCVGAEGPEGPGCRVLFHVLPLEAGLTPDILIPPEGIPGSAQQVIQVDRDTILVSFE
RCVRIVNMQGEPTATLAPELTFDFPIETVVCLQDSVLAFWSHGMQGRSLDTNEVTQEITD
ETRIFRVLGAHRDIILESIPTDNPEAHSNLYILTGHQSTY
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50316253
n/a
NameBDBM50316253
Synonyms:CHEMBL1095627 | tert-Butyl 4-(6-(4-aminophenyl)-4-morpholino-1H-pyrazolo[3,4-d]pyrimidin-1-yl)piperidine-1-carboxylate
TypeSmall organic molecule
Emp. Form.C25H33N7O3
Mol. Mass.479.5746
SMILESCC(C)(C)OC(=O)N1CCC(CC1)n1ncc2c(nc(nc12)-c1ccc(N)cc1)N1CCOCC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: