Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAldose reductase (AR)
LigandBDBM50237838
Substrate/Competitorn/a
Meas. Tech.ChEMBL_627900
IC50 741±n/a nM
Citation Koukoulitsa CBailly FPegklidou KDemopoulos VJCotelle P Evaluation of aldose reductase inhibition and docking studies of 6'-nitro and 6',6''-dinitrorosmarinic acids. Eur J Med Chem 45:1663-6 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Aldose reductase (AR)
Name:Aldose reductase
Synonyms:AR | Aldo-keto reductase family 1 member B1 (AKR1B1) | Aldose Reductase (ALR2) | Aldose reductase
Type:Protein
Mol. Mass.:35855.50
Organism:Homo sapiens (Human)
Description:P15121. 4LAU; 2IKI; 4LB4; 2FZD; 2FZ8; 1US0
Residue:316
Sequence:
MASRLLLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQ
EKLREQVVKREELFIVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPTGFKPGK
EFFPLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFNHLQVEMILNKPGLKYKP
AVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAK
HNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYNRNWRVCA
LLSCTSHKDYPFHEEF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50237838
n/a
NameBDBM50237838
Synonyms:(R)-3-(4,5-dihydroxy-2-nitrophenyl)-2-(3-(4,5-dihydroxy-2-nitrophenyl)acryloyloxy)propanoic acid | 3-(4,5-dihydroxy-2-nitrophenyl)-2-(3-(4,5-dihydroxy-2-nitrophenyl)acryloyloxy)propanoic acid | CHEMBL261703
TypeSmall organic molecule
Emp. Form.C18H14N2O12
Mol. Mass.450.31
SMILESOC(=O)[C@@H](Cc1cc(O)c(O)cc1[N+]([O-])=O)OC(=O)\C=C\c1cc(O)c(O)cc1[N+]([O-])=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: