| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Cannabinoid receptor 2 |
|---|
| Ligand | BDBM50316513 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_630805 (CHEMBL1106560) |
|---|
| IC50 | 1500±n/a nM |
|---|
| Citation |  Yan, L; Huo, P; Debenham, JS; Madsen-Duggan, CB; Lao, J; Chen, RZ; Xiao, JC; Shen, CP; Stribling, DS; Shearman, LP; Strack, AM; Tsou, N; Ball, RG; Wang, J; Tong, X; Bateman, TJ; Reddy, VB; Fong, TM; Hale, JJ Discovery of N-[(4R)-6-(4-chlorophenyl)-7-(2,4-dichlorophenyl)-2,2-dimethyl-3,4-dihydro-2H-pyrano[2,3-b]pyridin-4-yl]-5-methyl-1H-pyrazole-3-carboxamide (MK-5596) as a novel cannabinoid-1 receptor (CB1R) inverse agonist for the treatment of obesity. J Med Chem53:4028-37 (2010) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Cannabinoid receptor 2 |
|---|
| Name: | Cannabinoid receptor 2 |
|---|
| Synonyms: | CANNABINOID CB2 | CB-2 | CB2 | CNR2_RAT | Cannabinoid CB2 receptor | Cannabinoid receptor | Cnr2 | rCB2 |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 39366.68 |
|---|
| Organism: | Rattus norvegicus (Rat) |
|---|
| Description: | Q9QZN9 |
|---|
| Residue: | 360 |
|---|
| Sequence: | MAGCRELELTNGSNGGLEFNPMKEYMILSDAQQIAVAVLCTLMGLLSALENVAVLYLILS
SQRLRRKPSYLFIGSLAGADFLASVIFACNFVIFHVFHGVDSRNIFLLKIGSVTMTFTAS
VGSLLLTAVDRYLCLCYPPTYKALVTRGRALVALGVMWVLSALISYLPLMGWTCCPSPCS
ELFPLIPNDYLLGWLLFIAILFSGIIYTYGYVLWKAHQHVASLAEHQDRQVPGIARMRLD
VRLAKTLGLVMAVLLICWFPALALMGHSLVTTLSDKVKEAFAFCSMLCLVNSMINPIIYA
LRSGEIRSAAQHCLTGWKKYLQGLGSEGKEEAPKSSVTETEAEVKTTTGPGSRTPGCSNC
|
|
|
|---|
| BDBM50316513 |
|---|
| n/a |
|---|
| Name | BDBM50316513 |
|---|
| Synonyms: | CHEMBL1096182 | N-((4R)-6-(4-chlorophenyl)-7-(2,4-dichlorophenyl)-2,2-dimethyl-3,4-dihydro-2H-pyrano[2,3-b]pyridin-4-yl)-5-methyl-1H-pyrazole-3-carboxamide |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C27H23Cl3N4O2 |
|---|
| Mol. Mass. | 541.856 |
|---|
| SMILES | Cc1cc([nH]n1)C(=O)N[C@@H]1CC(C)(C)Oc2nc(-c3ccc(Cl)cc3Cl)c(cc12)-c1ccc(Cl)cc1 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
