| Reaction Details |
|---|
 | Report a problem with these data |
| Target | 6,7-dimethyl-8-ribityllumazine synthase |
|---|
| Ligand | BDBM50316580 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_631469 (CHEMBL1113888) |
|---|
| Ki | 18000±n/a nM |
|---|
| Citation |  Talukdar, A; Morgunova, E; Duan, J; Meining, W; Foloppe, N; Nilsson, L; Bacher, A; Illarionov, B; Fischer, M; Ladenstein, R; Cushman, M Virtual screening, selection and development of a benzindolone structural scaffold for inhibition of lumazine synthase. Bioorg Med Chem18:3518-34 (2010) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| 6,7-dimethyl-8-ribityllumazine synthase |
|---|
| Name: | 6,7-dimethyl-8-ribityllumazine synthase |
|---|
| Synonyms: | RISB_MYCTU | ribH |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 16367.39 |
|---|
| Organism: | Mycobacterium tuberculosis |
|---|
| Description: | ChEMBL_631469 |
|---|
| Residue: | 160 |
|---|
| Sequence: | MKGGAGVPDLPSLDASGVRLAIVASSWHGKICDALLDGARKVAAGCGLDDPTVVRVLGAI
EIPVVAQELARNHDAVVALGVVIRGQTPHFDYVCDAVTQGLTRVSLDSSTPIANGVLTTN
TEEQALDRAGLPTSAEDKGAQATVAALATALTLRELRAHS
|
|
|
|---|
| BDBM50316580 |
|---|
| n/a |
|---|
| Name | BDBM50316580 |
|---|
| Synonyms: | 6-(2-oxo-1,2-dihydrobenzo[cd]indole-6-sulfonamido)hexyldihydrogen phosphate | CHEMBL1095867 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C17H21N2O7PS |
|---|
| Mol. Mass. | 428.397 |
|---|
| SMILES | OP(O)(=O)OCCCCCCNS(=O)(=O)c1ccc2NC(=O)c3cccc1c23 |
|---|
| Structure | 
|
|---|
Search and Browse
