| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Translocator protein |
|---|
| Ligand | BDBM50316600 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_631761 (CHEMBL1114782) |
|---|
| Kd | 3.17±n/a nM |
|---|
| Citation |  Taliani, S; Da Pozzo, E; Bellandi, M; Bendinelli, S; Pugliesi, I; Simorini, F; La Motta, C; Salerno, S; Marini, AM; Da Settimo, F; Cosimelli, B; Greco, G; Novellino, E; Martini, C Novel irreversible fluorescent probes targeting the 18 kDa translocator protein: synthesis and biological characterization. J Med Chem53:4085-93 (2010) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Translocator protein |
|---|
| Name: | Translocator protein |
|---|
| Synonyms: | Benzodiazepine receptors; peripheral & central | Bzrp | Mbr | Mitochondrial benzodiazepine receptor | PBR | PKBS | Peripheral benzodiazepine receptor (PBR) | Peripheral-Type Benzodiazepine Receptor | TSPO_RAT | Tspo |
|---|
| Type: | Mitochondrion membrane protein |
|---|
| Mol. Mass.: | 18945.84 |
|---|
| Organism: | Rattus norvegicus (rat) |
|---|
| Description: | Competitive binding experiments were performed on rat kidney mitochondrial membranes. |
|---|
| Residue: | 169 |
|---|
| Sequence: | MSQSWVPAVGLTLVPSLGGFMGAYFVRGEGLRWYASLQKPSWHPPRWTLAPIWGTLYSAM
GYGSYIIWKELGGFTEEAMVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLMLVSGVAT
ATTLAWHRVSPPAARLLYPYLAWLAFATMLNYYVWRDNSGRRGGSRLTE
|
|
|
|---|
| BDBM50316600 |
|---|
| n/a |
|---|
| Name | BDBM50316600 |
|---|
| Synonyms: | CHEMBL1097176 | N,N-Dipropyl-[5-isothiocyanato-2-phenylindol-3-yl)glyoxylamide |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C23H23N3O2S |
|---|
| Mol. Mass. | 405.513 |
|---|
| SMILES | CCCN(CCC)C(=O)C(=O)c1c([nH]c2ccc(cc12)N=C=S)-c1ccccc1 |
|---|
| Structure | 
|
|---|
Search and Browse
