Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAdenosine receptor A1
LigandBDBM50316849
Substrate/Competitorn/a
Meas. Tech.ChEMBL_632846
Ki 4±n/a nM
Citation Sirisha BNarsaiah BYakaiah TGayatri GSastry GNPrasad MRRao AR Synthesis and theoretical studies on energetics of novel N- and O- perfluoroalkyl triazole tagged thienopyrimidines--their potential as adenosine receptor ligands. Eur J Med Chem 45:1739-45 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Adenosine receptor A1
Name:Adenosine receptor
Synonyms:ADENOSINE A1 | ADENOSINE A1 high | ADENOSINE A1 low | Adenosine A1 receptor (A1) | Adenosine receptors A1
Type:Protein
Mol. Mass.:36704.13
Organism:Rattus norvegicus (rat)
Description:n/a
Residue:326
Sequence:
MPPYISAFQAAYIGIEVLIALVSVPGNVLVIWAVKVNQALRDATFCFIVSLAVADVAVGA
LVIPLAILINIGPQTYFHTCLMVACPVLILTQSSILALLAIAVDRYLRVKIPLRYKTVVT
QRRAAVAIAGCWILSLVVGLTPMFGWNNLSVVEQDWRANGSVGEPVIKCEFEKVISMEYM
VYFNFFVWVLPPLLLMVLIYLEVFYLIRKQLNKKVSASSGDPQKYYGKELKIAKSLALIL
FLFALSWLPLHILNCITLFCPTCQKPSILIYIAIFLTHGNSAMNPIVYAFRIHKFRVTFL
KIWNDHFRCQPKPPIDEDLPEEKAED
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50316849
n/a
NameBDBM50316849
Synonyms:2-(4-Fluorobenzyl)-5,6-dimethyl-3-prop-2-yn-1-ylthieno[2,3-d]pyrimidin-4(3H)-one | CHEMBL1088384
TypeSmall organic molecule
Emp. Form.C18H15FN2OS
Mol. Mass.326.388
SMILESCc1sc2nc(Cc3ccc(F)cc3)n(CC#C)c(=O)c2c1C
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: