Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAdenosine receptor A2a
LigandBDBM50161342
Substrate/Competitorn/a
Meas. Tech.ChEMBL_630130
Ki 0.1±n/a nM
Citation Shook BCRassnick SHall DRupert KCHeintzelman GRHansen KChakravarty DBullington JLScannevin RHMagliaro BWestover LCarroll KLampron LRussell RBranum SWells KDamon SYouells SLi XOsbourne MDemarest KTang YRhodes KJackson PF Methylene amine substituted arylindenopyrimidines as potent adenosine A(2A)/A(1) antagonists. Bioorg Med Chem Lett 20:2864-7 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Adenosine receptor A2a
Name:Adenosine receptor A2a
Synonyms:A2A adenosine receptor (hA2A) | ADENOSINE A2 | ADENOSINE A2a | ADORA2 | ADORA2A | Adenosine A2A receptor (A2AAR)
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:44716.46
Organism:Homo sapiens (Human)
Description:P29274
Residue:412
Sequence:
MPIMGSSVYITVELAIAVLAILGNVLVCWAVWLNSNLQNVTNYFVVSLAAADIAVGVLAI
PFAITISTGFCAACHGCLFIACFVLVLTQSSIFSLLAIAIDRYIAIRIPLRYNGLVTGTR
AKGIIAICWVLSFAIGLTPMLGWNNCGQPKEGKNHSQGCGEGQVACLFEDVVPMNYMVYF
NFFACVLVPLLLMLGVYLRIFLAARRQLKQMESQPLPGERARSTLQKEVHAAKSLAIIVG
LFALCWLPLHIINCFTFFCPDCSHAPLWLMYLAIVLSHTNSVVNPFIYAYRIREFRQTFR
KIIRSHVLRQQEPFKAAGTSARVLAAHGSDGEQVSLRLNGHPPGVWANGSAPHPERRPNG
YALGLVSGGSAQESQGNTGLPDVELLSHELKGVCPEPPGLDDPLAQDGAGVS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50161342
n/a
NameBDBM50161342
Synonyms:2-Amino-4-phenyl-indeno[1,2-d]pyrimidin-5-one | 2-amino-4-phenyl-5H-indeno[1,2-d]pyrimidin-5-one | CHEMBL369573
TypeSmall organic molecule
Emp. Form.C17H11N3O
Mol. Mass.273.2887
SMILESNc1nc2-c3ccccc3C(=O)c2c(n1)-c1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: