Reaction Details |
| Report a problem with these data |
Target | Ribosyldihydronicotinamide dehydrogenase [quinone] |
---|
Ligand | BDBM50317139 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_630842 (CHEMBL1109212) |
---|
IC50 | 31±n/a nM |
---|
Citation | Nolan, KA; Humphries, MP; Bryce, RA; Stratford, IJ Imidazoacridin-6-ones as novel inhibitors of the quinone oxidoreductase NQO2. Bioorg Med Chem Lett20:2832-6 (2010) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Ribosyldihydronicotinamide dehydrogenase [quinone] |
---|
Name: | Ribosyldihydronicotinamide dehydrogenase [quinone] |
Synonyms: | Metallothionein-3 | NMOR2 | NQO2 | NQO2_HUMAN | NRH dehydrogenase [quinone] 2 | NRH:quinone oxidoreductase 2 | QR2 | Quinone reductase 2 | Quinone reductase 2 (NQO2) | Ribosyldihydronicotinamide dehydrogenase [quinone] |
Type: | Protein |
Mol. Mass.: | 25917.25 |
Organism: | Homo sapiens (Human) |
Description: | P16083 |
Residue: | 231 |
Sequence: | MAGKKVLIVYAHQEPKSFNGSLKNVAVDELSRQGCTVTVSDLYAMNLEPRATDKDITGTL
SNPEVFNYGVETHEAYKQRSLASDITDEQKKVREADLVIFQFPLYWFSVPAILKGWMDRV
LCQGFAFDIPGFYDSGLLQGKLALLSVTTGGTAEMYTKTGVNGDSRYFLWPLQHGTLHFC
GFKVLAPQISFAPEIASEEERKGMVAAWSQRLQTIWKEEPIPCTAHWHFGQ
|
|
|
BDBM50317139 |
---|
n/a |
---|
Name | BDBM50317139 |
Synonyms: | 5-(2-(diethylamino)ethylamino)-7-hydroxy-10-methoxy-6H-imidazo[4,5,1-de]acridin-6-one | 5-(2-Diethylamino-ethylamino)-7-hydroxy-10-methoxy-2,10b-diaza-aceanthrylen-6-one | CHEMBL8219 | NSC-660840 |
Type | Small organic molecule |
Emp. Form. | C21H24N4O3 |
Mol. Mass. | 380.4403 |
SMILES | CCN(CC)CCNc1ccc2ncn3c2c1c(=O)c1c(O)ccc(OC)c31 |
Structure |
|