Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetRibosyldihydronicotinamide dehydrogenase [quinone]
LigandBDBM23926
Substrate/Competitorn/a
Meas. Tech.ChEMBL_630842
IC50 450±n/a nM
Citation Nolan KAHumphries MPBryce RAStratford IJ Imidazoacridin-6-ones as novel inhibitors of the quinone oxidoreductase NQO2. Bioorg Med Chem Lett 20:2832-6 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Ribosyldihydronicotinamide dehydrogenase [quinone]
Name:Ribosyldihydronicotinamide dehydrogenase [quinone]
Synonyms:Metallothionein-3 | NRH dehydrogenase [quinone] 2 | NRH:quinone oxidoreductase 2 | QR2 | Quinone reductase 2 | Quinone reductase 2 (NQO2) | Ribosyldihydronicotinamide dehydrogenase [quinone]
Type:Protein
Mol. Mass.:25917.25
Organism:Homo sapiens (Human)
Description:P16083
Residue:231
Sequence:
MAGKKVLIVYAHQEPKSFNGSLKNVAVDELSRQGCTVTVSDLYAMNLEPRATDKDITGTL
SNPEVFNYGVETHEAYKQRSLASDITDEQKKVREADLVIFQFPLYWFSVPAILKGWMDRV
LCQGFAFDIPGFYDSGLLQGKLALLSVTTGGTAEMYTKTGVNGDSRYFLWPLQHGTLHFC
GFKVLAPQISFAPEIASEEERKGMVAAWSQRLQTIWKEEPIPCTAHWHFGQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM23926
n/a
NameBDBM23926
Synonyms:(E)-resveratrol | 5-[(E)-2-(4-hydroxyphenyl)ethenyl]benzene-1,3-diol | CHEMBL165 | Resveratol | Stilbene, 2f | cid_445154 | resveratrol | trans-resveratrol
TypeSmall organic molecule
Emp. Form.C14H12O3
Mol. Mass.228.2433
SMILESOc1ccc(\C=C\c2cc(O)cc(O)c2)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: