Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSialidase
LigandBDBM50311583
Substrate/Competitorn/a
Meas. Tech.ChEMBL_631812
Ki 1780±n/a nM
Citation Nguyen PHNguyen TNKang KWNdinteh DTMbafor JTKim YROh WK Prenylated pterocarpans as bacterial neuraminidase inhibitors. Bioorg Med Chem 18:3335-44 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Sialidase
Name:Sialidase
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:42808.79
Organism:Clostridium perfringens
Description:ChEMBL_991336
Residue:382
Sequence:
MCNKNNTFEKNLDISHKPEPLILFNKDNNIWNSKYFRIPNIQLLNDGTILTFSDIRYNGP
DDHAYIDIASARSTDFGKTWSYNIAMKNNRIDSTYSRVMDSTTVITNTGRIILIAGSWNT
NGNWAMTTSTRRSDWSVQMIYSDDNGLTWSNKIDLTKDSSKVKNQPSNTIGWLGGVGSGI
VMDDGTIVMPAQISLRENNENNYYSLIIYSKDNGETWTMGNKVPNSNTSENMVIELDGAL
IMSTRYDYSGYRAAYISHDLGTTWEIYEPLNGKILTGKGSGCQGSFIKATTSNGHRIGLI
SAPKNTKGEYIRDNIAVYMIDFDDLSKGVQEICIPYPEDGNKLGGGYSCLSFKNNHLGIV
YEANGNIEYQDLTPYYSLINKQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50311583
n/a
NameBDBM50311583
Synonyms:Abyssinone II | CHEMBL508534 | phaseolidin | phaseollidin | sophorapterocarpan A
TypeSmall organic molecule
Emp. Form.C20H20O4
Mol. Mass.324.3704
SMILES[#6]\[#6](-[#6])=[#6]\[#6]-c1c2-[#8]-[#6@@H]-3-[#6@@H](-[#6]-[#8]-c4cc(-[#8])ccc-34)-c2ccc1-[#8] |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: