Reaction Details |
| Report a problem with these data |
Target | Histamine H4 receptor |
---|
Ligand | BDBM50317865 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_629977 (CHEMBL1112054) |
---|
Ki | 1.1±n/a nM |
---|
Citation | Ishikawa, M; Shinei, R; Yokoyama, F; Yamauchi, M; Oyama, M; Okuma, K; Nagayama, T; Kato, K; Kakui, N; Sato, Y Role of hydrophobic substituents on the terminal nitrogen of histamine in receptor binding and agonist activity: development of an orally active histamine type 3 receptor agonist and evaluation of its antistress activity in mice. J Med Chem53:3840-4 (2010) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Histamine H4 receptor |
---|
Name: | Histamine H4 receptor |
Synonyms: | AXOR35 | G-protein coupled receptor 105 | GPCR105 | GPRv53 | HH4R | HISTAMINE H4 | HRH4 | HRH4_HUMAN | Histamine H4 receptor | Histamine H4 receptor (H4R) | Histamine receptor (H3 and H4) | Pfi-013 | SP9144 |
Type: | G Protein-Coupled Receptor (GPCR) |
Mol. Mass.: | 44517.02 |
Organism: | Homo sapiens (Human) |
Description: | Binding assays were using CHO cells stably expressing hH4R receptors. |
Residue: | 390 |
Sequence: | MPDTNSTINLSLSTRVTLAFFMSLVAFAIMLGNALVILAFVVDKNLRHRSSYFFLNLAIS
DFFVGVISIPLYIPHTLFEWDFGKEICVFWLTTDYLLCTASVYNIVLISYDRYLSVSNAV
SYRTQHTGVLKIVTLMVAVWVLAFLVNGPMILVSESWKDEGSECEPGFFSEWYILAITSF
LEFVIPVILVAYFNMNIYWSLWKRDHLSRCQSHPGLTAVSSNICGHSFRGRLSSRRSLSA
STEVPASFHSERQRRKSSLMFSSRTKMNSNTIASKMGSFSQSDSVALHQREHVELLRARR
LAKSLAILLGVFAVCWAPYSLFTIVLSFYSSATGPKSVWYRIAFWLQWFNSFVNPLLYPL
CHKRFQKAFLKIFCIKKQPLPSQHSRSVSS
|
|
|
BDBM50317865 |
---|
n/a |
---|
Name | BDBM50317865 |
Synonyms: | 2-(2-(4-tert-Butylphenylthio)ethyl)-1H-imidazole | 4-(2-(4-tert-butylphenylthio)ethyl)-1H-imidazole | CHEMBL1098230 |
Type | Small organic molecule |
Emp. Form. | C15H20N2S |
Mol. Mass. | 260.398 |
SMILES | CC(C)(C)c1ccc(SCCc2cnc[nH]2)cc1 |
Structure |
|