Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetBeta-2 adrenergic receptor
LigandBDBM50318155
Substrate/Competitorn/a
Meas. Tech.ChEMBL_632382
IC50 2.3±n/a nM
Citation Baur FBeattie DBeer DBentley DBradley MBruce ICharlton SJCuenoud BErnst RFairhurst RAFaller BFarr DKeller TFozard JRFullerton JGarman SHatto JHayden CHe HHowes CJanus DJiang ZLewis CLoeuillet-Ritzler FMoser HReilly JSteward ASykes DTedaldi LTrifilieff ATweed MWatson SWissler EWyss D The identification of indacaterol as an ultralong-acting inhaled beta2-adrenoceptor agonist. J Med Chem 53:3675-84 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Beta-2 adrenergic receptor
Name:Beta-2 adrenergic receptor
Synonyms:adrenergic Beta2
Type:Enzyme Catalytic Domain
Mol. Mass.:46993.24
Organism:GUINEA PIG
Description:adrenergic Beta2 ADRB2 GUINEA PIG::Q8K4Z4
Residue:418
Sequence:
MGHLGNGSDFLLAPNASHAPDHNVTRERDEAWVVGMAIVMSLIVLAIVFGNVLVITAIAK
FERLQTVTNYFITSLACADLVMGLAVVPFGASHILMNMWTFGNFWCEFWTSIDVLCVTAS
IETLCVIAVDRYFAITSPFKYQSLLTKNKARVVILMVWVVSGLTSFLPIQMHWYRATHKD
AINCYAEETCCDFFTNQAYAIASSIVSFYLPLVVMVFVYSRVFQVAKKQLQKIDRSEGRF
HTQNLSQVEQDGRSGHGLRRSSKFYLKEHKALKTLGIIMGTFTLCWLPFFIVNIVHVIQD
NLIPKEVYILLNWVGYVNSAFNPLIYCRSPDFRIAFQELLCLRRSALKAYGNDCSSNSNG
KTDYTGEPNVCHQGQEKERELLCEDPPGTEDLVSCPGTVPSDSIDSQGRNYSTNDSLL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50318155
n/a
NameBDBM50318155
Synonyms:8-Hydroxy-5-[(R)-1-hydroxy-2-(5,6-dimethoxyindan-2-ylamino)-ethyl]-1H-quinolin-2-one | CHEMBL1094486
TypeSmall organic molecule
Emp. Form.C22H24N2O5
Mol. Mass.396.4364
SMILESCOc1cc2CC(Cc2cc1OC)NC[C@H](O)c1ccc(O)c2[nH]c(=O)ccc12 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: