| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Procathepsin L |
|---|
| Ligand | BDBM50318712 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_633765 (CHEMBL1119329) |
|---|
| Ki | 37500±n/a nM |
|---|
| Citation |  Machon, U; Büchold, C; Stempka, M; Schirmeister, T; Gelhaus, C; Leippe, M; Gut, J; Rosenthal, PJ; Kisker, C; Leyh, M; Schmuck, C On-bead screening of a combinatorial fumaric acid derived peptide library yields antiplasmodial cysteine protease inhibitors with unusual peptide sequences. J Med Chem52:5662-72 (2009) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Procathepsin L |
|---|
| Name: | Procathepsin L |
|---|
| Synonyms: | CATL1_BOVIN | CTSL | CTSL1 | Cathepsin L | Cathepsin L1 heavy chain | Cathepsin L1 light chain |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 37349.52 |
|---|
| Organism: | Bos taurus (bovine) |
|---|
| Description: | Bovine liver cathepsin L was purchased from Calbiochem. |
|---|
| Residue: | 334 |
|---|
| Sequence: | MNPSFFLTVLCLGVASAAPKLDPNLDAHWHQWKATHRRLYGMNEEEWRRAVWEKNKKIID
LHNQEYSEGKHGFRMAMNAFGDMTNEEFRQVMNGFQNQKHKKGKLFHEPLLVDVPKSVDW
TKKGYVTPVKNQGQCGSCWAFSATGALEGQMFRKTGKLVSLSEQNLVDCSRAQGNQGCNG
GLMDNAFQYIKDNGGLDSEESYPYLATDTNSCNYKPECSAANDTGFVDIPQREKALMKAV
ATVGPISVAIDAGHTSFQFYKSGIYYDPDCSSKDLDHGVLVVGYGFEGTDSNNNKFWIVK
NSWGPEWGWNGYVKMAKDQNNHCGIATAASYPTV
|
|
|
|---|
| BDBM50318712 |
|---|
| n/a |
|---|
| Name | BDBM50318712 |
|---|
| Synonyms: | (2S,15S,18S,21S,24S)-15-(2-amino-2-oxoethyl)-2-benzyl-24-carbamoyl-18-cyclohexyl-21-isopropyl-25-methyl-4,7,10,13,16,19,22-heptaoxo-3,6,9,14,17,20,23-heptaazahexacos-11-en-1-oic acid | CHEMBL1086432 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C39H57N9O11 |
|---|
| Mol. Mass. | 827.9236 |
|---|
| SMILES | CC(C)[C@H](NC(=O)[C@@H](NC(=O)[C@@H](NC(=O)[C@H](CC(N)=O)NC(=O)\C=C\C(=O)NCC(=O)NCC(=O)N[C@@H](Cc1ccccc1)C(O)=O)C1CCCCC1)C(C)C)C(N)=O |r| |
|---|
| Structure | 
|
|---|
Search and Browse
