Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHistone deacetylase 3
LigandBDBM19149
Substrate/Competitorn/a
Meas. Tech.ChEMBL_633818
Ki 29±n/a nM
Citation Wang HLim ZYZhou YNg MLu TLee KSangthongpitag KGoh KCWang XWu XKhng HHGoh SKOng WCBonday ZSun ET Acylurea connected straight chain hydroxamates as novel histone deacetylase inhibitors: Synthesis, SAR, and in vivo antitumor activity. Bioorg Med Chem Lett 20:3314-21 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Histone deacetylase 3
Name:Histone deacetylase 1/2/3
Synonyms:HD3 | Histone deacetylase 3 (HDAC3) | Human HDAC3 | RPD3-2 | SMAP45
Type:Enzyme
Mol. Mass.:48829.55
Organism:Homo sapiens (Human)
Description:n/a
Residue:428
Sequence:
MAKTVAYFYDPDVGNFHYGAGHPMKPHRLALTHSLVLHYGLYKKMIVFKPYQASQHDMCR
FHSEDYIDFLQRVSPTNMQGFTKSLNAFNVGDDCPVFPGLFEFCSRYTGASLQGATQLNN
KICDIAINWAGGLHHAKKFEASGFCYVNDIVIGILELLKYHPRVLYIDIDIHHGDGVQEA
FYLTDRVMTVSFHKYGNYFFPGTGDMYEVGAESGRYYCLNVPLRDGIDDQSYKHLFQPVI
NQVVDFYQPTCIVLQCGADSLGCDRLGCFNLSIRGHGECVEYVKSFNIPLLVLGGGGYTV
RNVARCWTYETSLLVEEAISEELPYSEYFEYFAPDFTLHPDVSTRIENQNSRQYLDQIRQ
TIFENLKMLNHAPSVQIHDVPADLLTYDRTDEADAEERGPEENYSRPEAPNEFYDGDHDN
DKESDVEI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM19149
n/a
NameBDBM19149
Synonyms:CHEMBL98 | N-hydroxy-N'-phenyloctanediamide | SAHA | US10188756, Compound SAHA | US9115116, SAHA | US9353061, SAHA | US9428447, SAHA | US9695181, Vorinostat | Vorinostat | Zolinza | cid_5311 | suberoylanilide hydroxamic acid
TypeSmall organic molecule
Emp. Form.C14H20N2O3
Mol. Mass.264.3202
SMILESONC(=O)CCCCCCC(=O)Nc1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: