Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHistamine H4 receptor
LigandBDBM22559
Substrate/Competitorn/a
Meas. Tech.ChEMBL_634016
Ki 250±n/a nM
Citation Savall BMEdwards JPVenable JDBuzard DJThurmond RHack MMcGovern P Agonist/antagonist modulation in a series of 2-aryl benzimidazole H4 receptor ligands. Bioorg Med Chem Lett 20:3367-71 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Histamine H4 receptor
Name:Histamine H4 receptor
Synonyms:AXOR35 | G-protein coupled receptor 105 | GPRv53 | HH4R | HISTAMINE H4 | Histamine H4 receptor (H4R) | Histamine receptor (H3 and H4) | Pfi-013 | SP9144
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:44517.02
Organism:Homo sapiens (Human)
Description:Binding assays were using CHO cells stably expressing hH4R receptors.
Residue:390
Sequence:
MPDTNSTINLSLSTRVTLAFFMSLVAFAIMLGNALVILAFVVDKNLRHRSSYFFLNLAIS
DFFVGVISIPLYIPHTLFEWDFGKEICVFWLTTDYLLCTASVYNIVLISYDRYLSVSNAV
SYRTQHTGVLKIVTLMVAVWVLAFLVNGPMILVSESWKDEGSECEPGFFSEWYILAITSF
LEFVIPVILVAYFNMNIYWSLWKRDHLSRCQSHPGLTAVSSNICGHSFRGRLSSRRSLSA
STEVPASFHSERQRRKSSLMFSSRTKMNSNTIASKMGSFSQSDSVALHQREHVELLRARR
LAKSLAILLGVFAVCWAPYSLFTIVLSFYSSATGPKSVWYRIAFWLQWFNSFVNPLLYPL
CHKRFQKAFLKIFCIKKQPLPSQHSRSVSS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM22559
n/a
NameBDBM22559
Synonyms:1-{3-[4-(5-tert-butyl-1H-1,3-benzodiazol-2-yl)-2-chlorophenoxy]propyl}-N,N-dimethylpyrrolidin-3-amine | 2-arylbenzimidazole derivative, 5
TypeSmall organic molecule
Emp. Form.C26H35ClN4O
Mol. Mass.455.035
SMILESCN(C)C1CCN(CCCOc2ccc(cc2Cl)-c2nc3ccc(cc3[nH]2)C(C)(C)C)C1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: