Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetG protein-coupled receptor 44
LigandBDBM50319477
Substrate/Competitorn/a
Meas. Tech.ChEMBL_634231
Ki 430±n/a nM
Citation Tumey LNRobarge MJGleason ESong JMurphy SMEkema GDoucette CHanniford DPalmer MPawlowski GDanzig JLoftus MHunady KSherf BMays RWStricker-Krongrad ABrunden KRBennani YLHarrington JJ 3-Indolyl sultams as selective CRTh2 antagonists. Bioorg Med Chem Lett 20:3287-90 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
G protein-coupled receptor 44
Name:G protein-coupled receptor 44
Synonyms:CD_antigen=CD294 | Chemoattractant Receptor-homologous molecule expressed on T-helper type 2 cells (CRTH2) | Chemoattractant receptor-homologous molecule expressed on Th2 cells | Chemoattractant receptor-homologous molecule expressed on Th2 cells (CRTH2) | G-protein coupled receptor 44 | Prostaglandin D2 | Prostaglandin D2 receptor 2 | Prostaglandin D2 receptor 2 (PGD2)
Type:Enzyme
Mol. Mass.:43295.45
Organism:Homo sapiens (Human)
Description:Q9Y5Y4
Residue:395
Sequence:
MSANATLKPLCPILEQMSRLQSHSNTSIRYIDHAAVLLHGLASLLGLVENGVILFVVGCR
MRQTVVTTWVLHLALSDLLASASLPFFTYFLAVGHSWELGTTFCKLHSSIFFLNMFASGF
LLSAISLDRCLQVVRPVWAQNHRTVAAAHKVCLVLWALAVLNTVPYFVFRDTISRLDGRI
MCYYNVLLLNPGPDRDATCNSRQVALAVSKFLLAFLVPLAIIASSHAAVSLRLQHRGRRR
PGRFVRLVAAVVAAFALCWGPYHVFSLLEARAHANPGLRPLVWRGLPFVTSLAFFNSVAN
PVLYVLTCPDMLRKLRRSLRTVLESVLVDDSELGGAGSSRRRRTSSTARSASPLALCSRP
EEPRGPARLLGWLLGSCAASPQTGPLNRALSSTSS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50319477
n/a
NameBDBM50319477
Synonyms:CHEMBL1086341 | rac-[3-(1,1-Dioxo-2,3-dihydro-1H-1lambda*6*-benzo[d]isothiazol-3-yl)-5-fluoro-2-methyl-indol-1-yl]-acetic acid
TypeSmall organic molecule
Emp. Form.C18H15FN2O4S
Mol. Mass.374.386
SMILESCc1c(C2NS(=O)(=O)c3ccccc23)c2cc(F)ccc2n1CC(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: