| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Prostaglandin D2 receptor 2 |
|---|
| Ligand | BDBM50319487 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_634231 (CHEMBL1120178) |
|---|
| Ki | 13±n/a nM |
|---|
| Citation |  Tumey, LN; Robarge, MJ; Gleason, E; Song, J; Murphy, SM; Ekema, G; Doucette, C; Hanniford, D; Palmer, M; Pawlowski, G; Danzig, J; Loftus, M; Hunady, K; Sherf, B; Mays, RW; Stricker-Krongrad, A; Brunden, KR; Bennani, YL; Harrington, JJ 3-Indolyl sultams as selective CRTh2 antagonists. Bioorg Med Chem Lett20:3287-90 (2010) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Prostaglandin D2 receptor 2 |
|---|
| Name: | Prostaglandin D2 receptor 2 |
|---|
| Synonyms: | CD_antigen=CD294 | CRTH2 | Chemoattractant Receptor-homologous molecule expressed on T-helper type 2 cells (CRTH2) | Chemoattractant receptor-homologous molecule expressed on Th2 cells | Chemoattractant receptor-homologous molecule expressed on Th2 cells (CRTH2) | DL1R | G protein-coupled receptor 44 | G-protein coupled receptor 44 | GPR44 | PD2R2_HUMAN | PTGDR2 | Prostaglandin D2 | Prostaglandin D2 receptor 2 | Prostaglandin D2 receptor 2 (PGD2) |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 43295.45 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Q9Y5Y4 |
|---|
| Residue: | 395 |
|---|
| Sequence: | MSANATLKPLCPILEQMSRLQSHSNTSIRYIDHAAVLLHGLASLLGLVENGVILFVVGCR
MRQTVVTTWVLHLALSDLLASASLPFFTYFLAVGHSWELGTTFCKLHSSIFFLNMFASGF
LLSAISLDRCLQVVRPVWAQNHRTVAAAHKVCLVLWALAVLNTVPYFVFRDTISRLDGRI
MCYYNVLLLNPGPDRDATCNSRQVALAVSKFLLAFLVPLAIIASSHAAVSLRLQHRGRRR
PGRFVRLVAAVVAAFALCWGPYHVFSLLEARAHANPGLRPLVWRGLPFVTSLAFFNSVAN
PVLYVLTCPDMLRKLRRSLRTVLESVLVDDSELGGAGSSRRRRTSSTARSASPLALCSRP
EEPRGPARLLGWLLGSCAASPQTGPLNRALSSTSS
|
|
|
|---|
| BDBM50319487 |
|---|
| n/a |
|---|
| Name | BDBM50319487 |
|---|
| Synonyms: | CHEMBL1084894 | rac-{2-Methyl-3-[2-(3-methyl-5-phenyl-isoxazol-4-ylmethyl)-1,1-dioxo-2,3-dihydro-1H-1lambda*6*-benzo[d]isothiazol-3-yl]-indol-1-yl}-acetic acid |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C29H25N3O5S |
|---|
| Mol. Mass. | 527.591 |
|---|
| SMILES | Cc1noc(c1CN1C(c2ccccc2S1(=O)=O)c1c(C)n(CC(O)=O)c2ccccc12)-c1ccccc1 |
|---|
| Structure | 
|
|---|
Search and Browse
