Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCyclin-dependent kinase 4
LigandBDBM50319621
Substrate/Competitorn/a
Meas. Tech.ChEMBL_634456
Ki>10000±n/a nM
Citation Wang SMidgley CAScaërou FGrabarek JBGriffiths GJackson WKontopidis GMcClue SJMcInnes CMeades CMezna MPlater AStuart IThomas MPWood GClarke RGBlake DGZheleva DILane DPJackson RCGlover DMFischer PM Discovery of N-phenyl-4-(thiazol-5-yl)pyrimidin-2-amine aurora kinase inhibitors. J Med Chem 53:4367-78 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Cyclin-dependent kinase 4
Name:CDK4/CDK9
Synonyms:CDK4 | Cell division protein kinase 4 | Cyclin-dependent kinase 4 (CDK 4) | PSK-J3
Type:Enzyme Subunit
Mol. Mass.:33731.96
Organism:Homo sapiens (Human)
Description:P11802
Residue:303
Sequence:
MATSRYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNGGGGGGGLPISTVREVALL
RRLEAFEHPNVVRLMDVCATSRTDREIKVTLVFEHVDQDLRTYLDKAPPPGLPAETIKDL
MRQFLRGLDFLHANCIVHRDLKPENILVTSGGTVKLADFGLARIYSYQMALTPVVVTLWY
RAPEVLLQSTYATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPR
DVSLPRGAFPPRGPRPVQSVVPEMEESGAQLLLEMLTFNPHKRISAFRALQHSYLHKDEG
NPE
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50319621
n/a
NameBDBM50319621
Synonyms:CHEMBL1086088 | N-Ethyl-4-methyl-5-(2-(3,4,5-trimethoxyphenylamino)pyrimidin-4-yl)thiazol-2-amine
TypeSmall organic molecule
Emp. Form.C19H23N5O3S
Mol. Mass.401.483
SMILESCCNc1nc(C)c(s1)-c1ccnc(Nc2cc(OC)c(OC)c(OC)c2)n1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: