| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Fatty acid-binding protein, heart |
|---|
| Ligand | BDBM50319698 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_634823 (CHEMBL1120073) |
|---|
| IC50 | >432000±n/a nM |
|---|
| Citation |  Cai, H; Yan, G; Zhang, X; Gorbenko, O; Wang, H; Zhu, W Discovery of highly selective inhibitors of human fatty acid binding protein 4 (FABP4) by virtual screening. Bioorg Med Chem Lett20:3675-9 (2010) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Fatty acid-binding protein, heart |
|---|
| Name: | Fatty acid-binding protein, heart |
|---|
| Synonyms: | FABP11 | FABP3 | FABPH_HUMAN | Fatty acid binding protein muscle | MDGI |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 14858.36 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | ChEMBL_1463784 |
|---|
| Residue: | 133 |
|---|
| Sequence: | MVDAFLGTWKLVDSKNFDDYMKSLGVGFATRQVASMTKPTTIIEKNGDILTLKTHSTFKN
TEISFKLGVEFDETTADDRKVKSIVTLDGGKLVHLQKWDGQETTLVRELIDGKLILTLTH
GTAVCTRTYEKEA
|
|
|
|---|
| BDBM50319698 |
|---|
| n/a |
|---|
| Name | BDBM50319698 |
|---|
| Synonyms: | 2-(2-(3-chloro-4-fluorophenylamino)-2-oxoethylthio)acetic acid | CHEMBL1086224 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C10H9ClFNO3S |
|---|
| Mol. Mass. | 277.7 |
|---|
| SMILES | OC(=O)CSCC(=O)Nc1ccc(F)c(Cl)c1 |
|---|
| Structure | 
|
|---|
Search and Browse
