| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Cannabinoid receptor 2 |
|---|
| Ligand | BDBM50320182 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_635413 (CHEMBL1120213) |
|---|
| IC50 | >2000±n/a nM |
|---|
| Citation |  Madsen-Duggan, CB; Debenham, JS; Walsh, TF; Yan, L; Huo, P; Wang, J; Tong, X; Lao, J; Fong, TM; Xiao, JC; Huang, CR; Shen, CP; Stribling, DS; Shearman, LP; Strack, AM; Goulet, MT; Hale, JJ Dihydro-pyrano[2,3-b]pyridines and tetrahydro-1,8-naphthyridines as CB1 receptor inverse agonists: synthesis, SAR and biological evaluation. Bioorg Med Chem Lett20:3750-4 (2010) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Cannabinoid receptor 2 |
|---|
| Name: | Cannabinoid receptor 2 |
|---|
| Synonyms: | CANNABINOID CB2 | CB-2 | CB2 | CB2A | CB2B | CNR2 | CNR2_HUMAN | CX5 | Cannabinoid CB2 receptor | Cannabinoid receptor 2 (CB2) | Cannabinoid receptor 2 (CB2R) | hCB2 |
|---|
| Type: | G Protein-Coupled Receptor (GPCR) |
|---|
| Mol. Mass.: | 39690.94 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P34972 |
|---|
| Residue: | 360 |
|---|
| Sequence: | MEECWVTEIANGSKDGLDSNPMKDYMILSGPQKTAVAVLCTLLGLLSALENVAVLYLILS
SHQLRRKPSYLFIGSLAGADFLASVVFACSFVNFHVFHGVDSKAVFLLKIGSVTMTFTAS
VGSLLLTAIDRYLCLRYPPSYKALLTRGRALVTLGIMWVLSALVSYLPLMGWTCCPRPCS
ELFPLIPNDYLLSWLLFIAFLFSGIIYTYGHVLWKAHQHVASLSGHQDRQVPGMARMRLD
VRLAKTLGLVLAVLLICWFPVLALMAHSLATTLSDQVKKAFAFCSMLCLINSMVNPVIYA
LRSGEIRSSAHHCLAHWKKCVRGLGSEAKEEAPRSSVTETEADGKITPWPDSRDLDLSDC
|
|
|
|---|
| BDBM50320182 |
|---|
| n/a |
|---|
| Name | BDBM50320182 |
|---|
| Synonyms: | 7'-(2-chlorophenyl)-6'-(4-chlorophenyl)-1-methylspiro[piperidine-4,2'-pyrano[2,3-b]pyridin]-4'(3'H)-one | CHEMBL1086492 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C25H22Cl2N2O2 |
|---|
| Mol. Mass. | 453.36 |
|---|
| SMILES | CN1CCC2(CC1)CC(=O)c1cc(-c3ccc(Cl)cc3)c(nc1O2)-c1ccccc1Cl |
|---|
| Structure | 
|
|---|
Search and Browse
