Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetFalcipain-2
LigandBDBM50187253
Substrate/Competitorn/a
Meas. Tech.ChEMBL_641372
Ki 4000±n/a nM
Citation Ettari RZappalà MMicale NSchirmeister TGelhaus CLeippe MEvers AGrasso S Synthesis of novel peptidomimetics as inhibitors of protozoan cysteine proteases falcipain-2 and rhodesain. Eur J Med Chem 45:3228-33 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Falcipain-2
Name:Falcipain 2
Synonyms:Cysteine protease falcipain-2 | Falcipain 2
Type:Enzyme
Mol. Mass.:55912.60
Organism:Plasmodium falciparum
Description:Recombinant falcipain-2.
Residue:484
Sequence:
MDYNMDYAPHEVISQQGERFVDKYVDRKILKNKKSLLVIISLSVLSVVGFVLFYFTPNSR
KSDLFKNSSVENNNDDYIINSLLKSPNGKKFIVSKIDEALSFYDSKKNDINKYNEGNNNN
NADFKGLSLFKENTPSNNFIHNKDYFINFFDNKFLMNNAEHINQFYMFIKTNNKQYNSPN
EMKERFQVFLQNAHKVNMHNNNKNSLYKKELNRFADLTYHEFKNKYLSLRSSKPLKNSKY
LLDQMNYEEVIKKYRGEENFDHAAYDWRLHSGVTPVKDQKNCGSCWAFSSIGSVESQYAI
RKNKLITLSEQELVDCSFKNYGCNGGLINNAFEDMIELGGICPDGDYPYVSDAPNLCNID
RCTEKYGIKNYLSVPDNKLKEALRFLGPISISVAVSDDFAFYKEGIFDGECGDQLNHAVM
LVGFGMKEIVNPLTKKGEKHYYYIIKNSWGQQWGERGFINIETDESGLMRKCGLGTDAFI
PLIE
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50187253
n/a
NameBDBM50187253
Synonyms:((3R)-1-(2-((3S)-2-hydroxy-5-oxotetrahydrofuran-3-ylamino)-2-oxoethyl)-2-oxo-5-phenyl-2,3-dihydro-1H-benzo[e][1,4]diazepin-3-yl)methyl 4-chloro-2-(trifluoromethyl)phenylcarbamate | ((R)-1-(2-((3S)-2-hydroxy-5-oxo-tetrahydrofuran-3-ylamino)-2-oxoethyl)-2-oxo-5-phenyl-2,3-dihydro-1H-benzo[e][1,4]diazepin-3-yl)methyl 4-chloro-2-(trifluoromethyl)phenylcarbamate | (4-Chloro-2-trifluoromethylphenyl)-carbamic acid 1-[(2-hydroxy-5-oxo-tetrahydrofuran-3(S)-ylcarbamoyl)-methyl]-2-oxo-5-phenyl-2,3-dihydro-1H-benzo[e][1,4]diazepin-3(R)-ylmethyl ester | CHEMBL378223
TypeSmall organic molecule
Emp. Form.C30H24ClF3N4O7
Mol. Mass.644.982
SMILESOC1OC(=O)C[C@@H]1NC(=O)CN1c2ccccc2C(=N[C@H](COC(=O)Nc2ccc(Cl)cc2C(F)(F)F)C1=O)c1ccccc1 |c:20|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: