Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCholinesterases
LigandBDBM50322766
Substrate/Competitorn/a
Meas. Tech.ChEMBL_642381
IC50 5.5±n/a nM
Citation Fernández-Bachiller MIPérez CGonzález-Muñoz GCConde SLópez MGVillarroya MGarcía AGRodríguez-Franco MI Novel tacrine-8-hydroxyquinoline hybrids as multifunctional agents for the treatment of Alzheimer's disease, with neuroprotective, cholinergic, antioxidant, and copper-complexing properties. J Med Chem 53:4927-37 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Cholinesterases
Name:Cholinesterases; ACHE & BCHE
Synonyms:AChE | Acetylcholinesterase (AChE) | Acetylcholinesterase (human AChE)
Type:Enzyme
Mol. Mass.:67792.70
Organism:Homo sapiens (Human)
Description:P22303
Residue:614
Sequence:
MRPPQCLLHTPSLASPLLLLLLWLLGGGVGAEGREDAELLVTVRGGRLRGIRLKTPGGPV
SAFLGIPFAEPPMGPRRFLPPEPKQPWSGVVDATTFQSVCYQYVDTLYPGFEGTEMWNPN
RELSEDCLYLNVWTPYPRPTSPTPVLVWIYGGGFYSGASSLDVYDGRFLVQAERTVLVSM
NYRVGAFGFLALPGSREAPGNVGLLDQRLALQWVQENVAAFGGDPTSVTLFGESAGAASV
GMHLLSPPSRGLFHRAVLQSGAPNGPWATVGMGEARRRATQLAHLVGCPPGGTGGNDTEL
VACLRTRPAQVLVNHEWHVLPQESVFRFSFVPVVDGDFLSDTPEALINAGDFHGLQVLVG
VVKDEGSYFLVYGAPGFSKDNESLISRAEFLAGVRVGVPQVSDLAAEAVVLHYTDWLHPE
DPARLREALSDVVGDHNVVCPVAQLAGRLAAQGARVYAYVFEHRASTLSWPLWMGVPHGY
EIEFIFGIPLDPSRNYTAEEKIFAQRLMRYWANFARTGDPNEPRDPKAPQWPPYTAGAQQ
YVSLDLRPLEVRRGLRAQACAFWNRFLPKLLSATDTLDEAERQWKAEFHRWSSYMVHWKN
QFDHYSKQDRCSDL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50322766
n/a
NameBDBM50322766
Synonyms:7-{[9-(1,2,3,4-Tetrahydroacridin-9-ylamino)nonylamino]methyl}-quinolin-8-ol Dihydrochloride | CHEMBL1173662
TypeSmall organic molecule
Emp. Form.C32H40N4O
Mol. Mass.496.6862
SMILESOc1c(CNCCCCCCCCCNc2c3CCCCc3nc3ccccc23)ccc2cccnc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: