| Reaction Details |
|---|
 | Report a problem with these data |
| Target | B1 bradykinin receptor |
|---|
| Ligand | BDBM50322869 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_644658 (CHEMBL1211637) |
|---|
| Ki | 30±n/a nM |
|---|
| Citation |  Liu, Q; Qian, W; Li, A; Biswas, K; Chen, JJ; Fotsch, C; Han, N; Yuan, C; Arik, L; Biddlecome, G; Johnson, E; Kumar, G; Lester-Zeiner, D; Ng, GY; Hungate, RW; Askew, BC Aryl sulfonamides containing tetralin allylic amines as potent and selective bradykinin B1 receptor antagonists. Bioorg Med Chem Lett20:4593-7 (2010) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| B1 bradykinin receptor |
|---|
| Name: | B1 bradykinin receptor |
|---|
| Synonyms: | B1 BRADYKININ | B1 bradykinin receptor | B1R | BDKRB1 | BK-1 receptor | BKRB1_HUMAN | BRADYB1 | Bradykinin B1 receptor |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 40508.87 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P46663 |
|---|
| Residue: | 353 |
|---|
| Sequence: | MASSWPPLELQSSNQSQLFPQNATACDNAPEAWDLLHRVLPTFIISICFFGLLGNLFVLL
VFLLPRRQLNVAEIYLANLAASDLVFVLGLPFWAENIWNQFNWPFGALLCRVINGVIKAN
LFISIFLVVAISQDRYRVLVHPMASRRQQRRRQARVTCVLIWVVGGLLSIPTFLLRSIQA
VPDLNITACILLLPHEAWHFARIVELNILGFLLPLAAIVFFNYHILASLRTREEVSRTRC
GGRKDSKTTALILTLVVAFLVCWAPYHFFAFLEFLFQVQAVRGCFWEDFIDLGLQLANFF
AFTNSSLNPVIYVFVGRLFRTKVWELYKQCTPKSLAPISSSHRKEIFQLFWRN
|
|
|
|---|
| BDBM50322869 |
|---|
| n/a |
|---|
| Name | BDBM50322869 |
|---|
| Synonyms: | (R)-N-((R)-6-(3-(cyclopentylamino)prop-1-en-2-yl)-1,2,3,4-tetrahydronaphthalen-1-yl)-3-phenyl-3-(3-(trifluoromethyl)phenylsulfonamido)propanamide | CHEMBL1210755 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C34H38F3N3O3S |
|---|
| Mol. Mass. | 625.744 |
|---|
| SMILES | FC(F)(F)c1cccc(c1)S(=O)(=O)N[C@H](CC(=O)N[C@@H]1CCCc2cc(ccc12)C(=C)CNC1CCCC1)c1ccccc1 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
