Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMuscarinic acetylcholine receptor M1
LigandBDBM50323040
Substrate/Competitorn/a
Meas. Tech.ChEMBL_643619
IC50>10000±n/a nM
Citation Gattinoni SSimone CDDallavalle SFezza FNannei RBattista NMinetti PQuattrociocchi GCaprioli ABorsini FCabri WPenco SMerlini LMaccarrone M A new group of oxime carbamates as reversible inhibitors of fatty acid amide hydrolase. Bioorg Med Chem Lett 20:4406-11 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Muscarinic acetylcholine receptor M1
Name:Muscarinic acetylcholine receptor M1
Synonyms:CHRM1 | Cholinergic receptor, muscarinic 1 | Cholinergic, muscarinic M1
Type:Protein
Mol. Mass.:51442.54
Organism:Homo sapiens (Human)
Description:P11229
Residue:460
Sequence:
MNTSAPPAVSPNITVLAPGKGPWQVAFIGITTGLLSLATVTGNLLVLISFKVNTELKTVN
NYFLLSLACADLIIGTFSMNLYTTYLLMGHWALGTLACDLWLALDYVASNASVMNLLLIS
FDRYFSVTRPLSYRAKRTPRRAALMIGLAWLVSFVLWAPAILFWQYLVGERTVLAGQCYI
QFLSQPIITFGTAMAAFYLPVTVMCTLYWRIYRETENRARELAALQGSETPGKGGGSSSS
SERSQPGAEGSPETPPGRCCRCCRAPRLLQAYSWKEEEEEDEGSMESLTSSEGEEPGSEV
VIKMPMVDPEAQAPTKQPPRSSPNTVKRPTKKGRDRAGKGQKPRGKEQLAKRKTFSLVKE
KKAARTLSAILLAFILTWTPYNIMVLVSTFCKDCVPETLWELGYWLCYVNSTINPMCYAL
CNKAFRDTFRLLLLCRWDKRRWRKIPKRPGSVHRTPSRQC
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50323040
n/a
NameBDBM50323040
Synonyms:1-(3-Thiophen-2-yl-phenyl)-ethanone, O-(phenylaminocarbonyl)oxime | CHEMBL1210154
TypeSmall organic molecule
Emp. Form.C19H16N2O2S
Mol. Mass.336.408
SMILESCC(=NOC(=O)Nc1ccccc1)c1cccc(c1)-c1cccs1 |w:2.2|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: