Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCarbonic Anhydrase XIII
LigandBDBM50323740
Substrate/Competitorn/a
Meas. Tech.ChEMBL_646963
Ki 690±n/a nM
Citation Carta FTemperini CInnocenti AScozzafava AKaila KSupuran CT Polyamines inhibit carbonic anhydrases by anchoring to the zinc-coordinated water molecule. J Med Chem 53:5511-22 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Carbonic Anhydrase XIII
Name:Carbonic anhydrase XIII
Synonyms:CA-XIII | Carbonate dehydratase XIII | Carbonic anhydrase 13
Type:Enzyme
Mol. Mass.:29522.80
Organism:Mus musculus (mouse)
Description:Murine cloned isozyme
Residue:262
Sequence:
MARLSWGYGEHNGPIHWNELFPIADGDQQSPIEIKTKEVKYDSSLRPLSIKYDPASAKII
SNSGHSFNVDFDDTEDKSVLRGGPLTGNYRLRQFHLHWGSADDHGSEHVVDGVRYAAELH
VVHWNSDKYPSFVEAAHESDGLAVLGVFLQIGEHNPQLQKITDILDSIKEKGKQTRFTNF
DPLCLLPSSWDYWTYPGSLTVPPLLESVTWIVLKQPISISSQQLARFRSLLCTAEGESAA
FLLSNHRPPQPLKGRRVRASFY
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50323740
n/a
NameBDBM50323740
Synonyms:CHEMBL303004
TypeSmall organic molecule
Emp. Form.C6H16N2
Mol. Mass.116.2046
SMILESNCCCCCCN
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: