Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMonocarboxylate transporter 1
LigandBDBM22000
Substrate/Competitorn/a
Meas. Tech.ChEMBL_653483
Ki 0.707946±n/a nM
Citation Murray CMHutchinson RBantick JRBelfield GPBenjamin ADBrazma DBundick RVCook IDCraggs RIEdwards SEvans LRHarrison RHolness EJackson APJackson CGKingston LPPerry MWRoss ARRugman PASidhu SSSullivan MTaylor-Fishwick DAWalker PCWhitehead YMWilkinson DJWright ADonald DK Monocarboxylate transporter MCT1 is a target for immunosuppression. Nat Chem Biol 1:371-6 (2005) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Monocarboxylate transporter 1
Name:Monocarboxylate transporter 1
Synonyms:MCT 1 | Solute carrier family 16 member 1
Type:PROTEIN
Mol. Mass.:53956.64
Organism:Homo sapiens (Human)
Description:ChEMBL_1451367
Residue:500
Sequence:
MPPAVGGPVGYTPPDGGWGWAVVIGAFISIGFSYAFPKSITVFFKEIEGIFHATTSEVSW
ISSIMLAVMYGGGPISSILVNKYGSRIVMIVGGCLSGCGLIAASFCNTVQQLYVCIGVIG
GLGLAFNLNPALTMIGKYFYKRRPLANGLAMAGSPVFLCTLAPLNQVFFGIFGWRGSFLI
LGGLLLNCCVAGALMRPIGPKPTKAGKDKSKASLEKAGKSGVKKDLHDANTDLIGRHPKQ
EKRSVFQTINQFLDLTLFTHRGFLLYLSGNVIMFFGLFAPLVFLSSYGKSQHYSSEKSAF
LLSILAFVDMVARPSMGLVANTKPIRPRIQYFFAASVVANGVCHMLAPLSTTYVGFCVYA
GFFGFAFGWLSSVLFETLMDLVGPQRFSSAVGLVTIVECCPVLLGPPLLGRLNDMYGDYK
YTYWACGVVLIISGIYLFIGMGINYRLLAKEQKANEQKKESKEEETSIDVAGKPNEVTKA
AESPDQKDTDGGPKEEESPV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM22000
n/a
NameBDBM22000
Synonyms:7-[(3-hydroxypropyl)sulfanyl]-2-methyl-4-(2-methylpropyl)-6-(naphthalen-1-ylmethyl)-1H,2H,6H-pyrrolo[3,4-d]pyridazin-1-one | 7-[(3-hydroxypropyl)sulfanyl]-2-methyl-4-(2-methylpropyl)-6-(naphthalen-1-ylmethyl)-2,6-dihydro-1H-pyrrolo[3,4-d]pyridazin-1-one | Pyrrolo[3,4-d]pyridazin-1-one, 2
Typen/a
Emp. Form.C25H29N3O2S
Mol. Mass.435.582
SMILESCC(C)Cc1nn(C)c(=O)c2c(SCCCO)n(Cc3cccc4ccccc34)cc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: