| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Monoglyceride lipase |
|---|
| Ligand | BDBM50240416 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_653421 (CHEMBL1226624) |
|---|
| IC50 | 1200±n/a nM |
|---|
| Citation |  Nomura, DK; Blankman, JL; Simon, GM; Fujioka, K; Issa, RS; Ward, AM; Cravatt, BF; Casida, JE Activation of the endocannabinoid system by organophosphorus nerve agents. Nat Chem Biol4:373-8 (2008) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Monoglyceride lipase |
|---|
| Name: | Monoglyceride lipase |
|---|
| Synonyms: | MAG lipase | MGLL_MOUSE | Mgll | Monoacylglycerol lipase | Monoglyceride Lipase (MGL) |
|---|
| Type: | Hydrolase |
|---|
| Mol. Mass.: | 33391.67 |
|---|
| Organism: | Mus musculus (mouse) |
|---|
| Description: | Assays were using membranes of recombinant MAG Lipase transiently transfected in COS-7 cells. |
|---|
| Residue: | 303 |
|---|
| Sequence: | MPEASSPRRTPQNVPYQDLPHLVNADGQYLFCRYWKPSGTPKALIFVSHGAGEHCGRYDE
LAHMLKGLDMLVFAHDHVGHGQSEGERMVVSDFQVFVRDVLQHVDTIQKDYPDVPIFLLG
HSMGGAISILVAAERPTYFSGMVLISPLVLANPESASTLKVLAAKLLNFVLPNMTLGRID
SSVLSRNKSEVDLYNSDPLVCRAGLKVCFGIQLLNAVARVERAMPRLTLPFLLLQGSADR
LCDSKGAYLLMESSRSQDKTLKMYEGAYHVLHRELPEVTNSVLHEVNSWVSHRIAAAGAG
CPP
|
|
|
|---|
| BDBM50240416 |
|---|
| n/a |
|---|
| Name | BDBM50240416 |
|---|
| Synonyms: | CHEMBL23838 | O,O-diethyl O-p-nitrophenyl phosphate | diethyl 4-nitrophenyl phosphate | diethyl p-nitrophenyl phosphate | diethyl paraoxon | ethyl paraoxon | p-nitrophenyl diethyl phosphate | paraoxon | phosphacol | phosphoric acid diethyl 4-nitrophenyl ester |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C10H14NO6P |
|---|
| Mol. Mass. | 275.195 |
|---|
| SMILES | CCOP(=O)(OCC)Oc1ccc(cc1)[N+]([O-])=O |
|---|
| Structure | 
|
|---|
Search and Browse
