Reaction Details |
| Report a problem with these data |
Target | Monoglyceride lipase |
---|
Ligand | BDBM50240416 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_653421 (CHEMBL1226624) |
---|
IC50 | 1200±n/a nM |
---|
Citation | Nomura, DK; Blankman, JL; Simon, GM; Fujioka, K; Issa, RS; Ward, AM; Cravatt, BF; Casida, JE Activation of the endocannabinoid system by organophosphorus nerve agents. Nat Chem Biol4:373-8 (2008) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Monoglyceride lipase |
---|
Name: | Monoglyceride lipase |
Synonyms: | MAG lipase | MGLL_MOUSE | Mgll | Monoacylglycerol lipase | Monoglyceride Lipase (MGL) |
Type: | Hydrolase |
Mol. Mass.: | 33391.67 |
Organism: | Mus musculus (mouse) |
Description: | Assays were using membranes of recombinant MAG Lipase transiently transfected in COS-7 cells. |
Residue: | 303 |
Sequence: | MPEASSPRRTPQNVPYQDLPHLVNADGQYLFCRYWKPSGTPKALIFVSHGAGEHCGRYDE
LAHMLKGLDMLVFAHDHVGHGQSEGERMVVSDFQVFVRDVLQHVDTIQKDYPDVPIFLLG
HSMGGAISILVAAERPTYFSGMVLISPLVLANPESASTLKVLAAKLLNFVLPNMTLGRID
SSVLSRNKSEVDLYNSDPLVCRAGLKVCFGIQLLNAVARVERAMPRLTLPFLLLQGSADR
LCDSKGAYLLMESSRSQDKTLKMYEGAYHVLHRELPEVTNSVLHEVNSWVSHRIAAAGAG
CPP
|
|
|
BDBM50240416 |
---|
n/a |
---|
Name | BDBM50240416 |
Synonyms: | CHEMBL23838 | O,O-diethyl O-p-nitrophenyl phosphate | diethyl 4-nitrophenyl phosphate | diethyl p-nitrophenyl phosphate | diethyl paraoxon | ethyl paraoxon | p-nitrophenyl diethyl phosphate | paraoxon | phosphacol | phosphoric acid diethyl 4-nitrophenyl ester |
Type | Small organic molecule |
Emp. Form. | C10H14NO6P |
Mol. Mass. | 275.195 |
SMILES | CCOP(=O)(OCC)Oc1ccc(cc1)[N+]([O-])=O |
Structure |
|