Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHistamine H3 receptor
LigandBDBM50325063
Substrate/Competitorn/a
Meas. Tech.ChEMBL_651628
IC50 12±n/a nM
Citation Davenport AJStimson CCCorsi MVaidya DGlenn EJones TDBailey SGemkow MJFritz UHallett DJ Discovery of substituted benzyl tetrazoles as histamine H3 receptor antagonists. Bioorg Med Chem Lett 20:5165-9 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Histamine H3 receptor
Name:Histamine H3 receptor
Synonyms:HH3R
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:48607.98
Organism:Rattus norvegicus (rat)
Description:n/a
Residue:445
Sequence:
MERAPPDGLMNASGTLAGEAAAAGGARGFSAAWTAVLAALMALLIVATVLGNALVMLAFV
ADSSLRTQNNFFLLNLAISDFLVGAFCIPLYVPYVLTGRWTFGRGLCKLWLVVDYLLCAS
SVFNIVLISYDRFLSVTRAVSYRAQQGDTRRAVRKMALVWVLAFLLYGPAILSWEYLSGG
SSIPEGHCYAEFFYNWYFLITASTLEFFTPFLSVTFFNLSIYLNIQRRTRLRLDGGREAG
PEPPPDAQPSPPPAPPSCWGCWPKGHGEAMPLHRYGVGEAGPGVEAGEAALGGGSGGGAA
ASPTSSSGSSSRGTERPRSLKRGSKPSASSASLEKRMKMVSQSITQRFRLSRDKKVAKSL
AIIVSIFGLCWAPYTLLMIIRAACHGRCIPDYWYETSFWLLWANSAVNPVLYPLCHYSFR
RAFTKLLCPQKLKVQPHGSLEQCWK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50325063
n/a
NameBDBM50325063
Synonyms:4-((1-benzyl-1H-tetrazol-5-yl)(4-cyclobutyl-1,4-diazepan-1-yl)methyl)-N-methylbenzamide | CHEMBL1221429
TypeSmall organic molecule
Emp. Form.C26H33N7O
Mol. Mass.459.5865
SMILESCNC(=O)c1ccc(cc1)C(N1CCCN(CC1)C1CCC1)c1nnnn1Cc1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: