Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHydroxycarboxylic acid receptor 2
LigandBDBM50325924
Substrate/Competitorn/a
Meas. Tech.ChEMBL_652725
IC50 640±n/a nM
Citation Peters JUKühne HDehmlow HGrether UConte AHainzl DHertel CKratochwil NAOtteneder MNarquizian RPanousis CGRicklin FRöver S Pyrido pyrimidinones as selective agonists of the high affinity niacin receptor GPR109A: optimization of in vitro activity. Bioorg Med Chem Lett 20:5426-30 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Hydroxycarboxylic acid receptor 2
Name:Hydroxycarboxylic acid receptor 2
Synonyms:HM74 nicotinic acid GPCR
Type:PROTEIN
Mol. Mass.:41476.06
Organism:Rattus norvegicus
Description:ChEMBL_820675
Residue:360
Sequence:
MSKQNHFLVINGKNCCVFRDENIAKVLPPVLGLEFVFGLLGNGLALWIFCFHLKSWKSSR
IFLFNLAVADFLLIICLPFLTDNYVQNWDWRFGSIPCRVMLFMLAMNRQGSIIFLTVVAV
DRYFRVVHPHHFLNKISNRTAAIISCFLWGITIGLTVHLLYTDMMTRNGDANLCSSFSIC
YTFRWHDAMFLLEFFLPLGIILFCSGRIIWSLRQRQMDRHVKIKRAINFIMVVAIVFVIC
FLPSVAVRIRIFWLLYKHNVRNCDIYSSVDLAFFTTLSFTYMNSMLDPVVYYFSSPSFPN
FFSTCINRCLRRKTLGEPDNNRSTSVELTGDPSTIRSIPGALMTDPSEPGSPPYLASTSR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50325924
n/a
NameBDBM50325924
Synonyms:2-((3-chlorophenethyloxy)methyl)pyrido[2,3-d]pyrimidin-4(3H)-one | CHEMBL1224219
TypeSmall organic molecule
Emp. Form.C16H14ClN3O2
Mol. Mass.315.754
SMILESClc1cccc(CCOCc2nc3ncccc3c(=O)[nH]2)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: