Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Targetc-Jun N-terminal kinase, JNK
LigandBDBM50326053
Substrate/Competitorn/a
Meas. Tech.ChEMBL_655425
Kd 4400±n/a nM
Citation Zarrinkar PPGunawardane RNCramer MDGardner MFBrigham DBelli BKaraman MWPratz KWPallares GChao QSprankle KGPatel HKLevis MArmstrong RCJames JBhagwat SS AC220 is a uniquely potent and selective inhibitor of FLT3 for the treatment of acute myeloid leukemia (AML). Blood 114:2984-92 (2009) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
c-Jun N-terminal kinase, JNK
Name:c-Jun N-terminal kinase, JNK
Synonyms:JNK-46 | JNK1 | JNK1-alpha-1 | Mitogen-Activated Protein Kinase 8 (JNK1) | Stress-activated protein kinase JNK1 | c-Jun N-terminal kinase 1 | c-Jun N-terminal kinase 1 (JNK1) | c-Jun N-terminal kinase 1(JNK1) | c-Jun N-terminal kinase 2 (JNK2)
Type:Enzyme
Mol. Mass.:48297.57
Organism:Homo sapiens (Human)
Description:JNK-1 was purchased from Upstate Cell Signaling Solutions (formerly Upstate Biotechnology).
Residue:427
Sequence:
MSRSKRDNNFYSVEIGDSTFTVLKRYQNLKPIGSGAQGIVCAAYDAILERNVAIKKLSRP
FQNQTHAKRAYRELVLMKCVNHKNIIGLLNVFTPQKSLEEFQDVYIVMELMDANLCQVIQ
MELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSF
MMTPYVVTRYYRAPEVILGMGYKENVDLWSVGCIMGEMVCHKILFPGRDYIDQWNKVIEQ
LGTPCPEFMKKLQPTVRTYVENRPKYAGYSFEKLFPDVLFPADSEHNKLKASQARDLLSK
MLVIDASKRISVDEALQHPYINVWYDPSEAEAPPPKIPDKQLDEREHTIEEWKELIYKEV
MDLEERTKNGVIRGQPSPLGAAVINGSQHPSSSSSVNDVSSMSTDPTLASDTDSSLEAAA
GPLGCCR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50326053
n/a
NameBDBM50326053
Synonyms:CHEMBL608533 | PKC-412
TypeSmall organic molecule
Emp. Form.C35H30N4O4
Mol. Mass.570.6371
SMILESCO[C@@H]1[C@@H](C[C@H]2O[C@]1(C)n1c3ccccc3c3c4CNC(=O)c4c4c5ccccc5n2c4c13)N(C)C(=O)c1ccccc1 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: