Reaction Details |
| Report a problem with these data |
Target | Cyclin-dependent kinase 3 |
---|
Ligand | BDBM16673 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_655715 (CHEMBL1244759) |
---|
Kd | >10000±n/a nM |
---|
Citation | Zarrinkar, PP; Gunawardane, RN; Cramer, MD; Gardner, MF; Brigham, D; Belli, B; Karaman, MW; Pratz, KW; Pallares, G; Chao, Q; Sprankle, KG; Patel, HK; Levis, M; Armstrong, RC; James, J; Bhagwat, SS AC220 is a uniquely potent and selective inhibitor of FLT3 for the treatment of acute myeloid leukemia (AML). Blood114:2984-92 (2009) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Cyclin-dependent kinase 3 |
---|
Name: | Cyclin-dependent kinase 3 |
Synonyms: | CDK3 | CDK3/Cyclin E | CDK3_HUMAN | CDKN3 | Cyclin-dependent kinase 3 | Cyclin-dependent kinase 3 (CDK3) |
Type: | Enzyme |
Mol. Mass.: | 35053.88 |
Organism: | Homo sapiens (Human) |
Description: | Q00526 |
Residue: | 305 |
Sequence: | MDMFQKVEKIGEGTYGVVYKAKNRETGQLVALKKIRLDLEMEGVPSTAIREISLLKELKH
PNIVRLLDVVHNERKLYLVFEFLSQDLKKYMDSTPGSELPLHLIKSYLFQLLQGVSFCHS
HRVIHRDLKPQNLLINELGAIKLADFGLARAFGVPLRTYTHEVVTLWYRAPEILLGSKFY
TTAVDIWSIGCIFAEMVTRKALFPGDSEIDQLFRIFRMLGTPSEDTWPGVTQLPDYKGSF
PKWTRKGLEEIVPNLEPEGRDLLMQLLQYDPSQRITAKTALAHPYFSSPEPSPAARQYVL
QRFRH
|
|
|
BDBM16673 |
---|
n/a |
---|
Name | BDBM16673 |
Synonyms: | 4-[4-({[4-chloro-3-(trifluoromethyl)phenyl]carbamoyl}amino)phenoxy]-N-methylpyridine-2-carboxamide | 4-[4-[[4-chloro-3-(trifluoromethyl)phenyl]carbamoylamino]phenoxy]-N-methyl-picolinamide;tosylic acid | BAY 43-9006 | BAY 439006 | BAY439006 | CHEMBL1336 | Hit compound, 8 | Nexavar | Sorafenib | Sorafenib, 4 | US10183928, Sorafenib | US10202365, Compound Sorafenib | US10227329, Compound Sorafenib | US10584114, Compound Sorafenib | US10774070, Compound Sorafenib | US10980809, Example Sorafenib | US11279688, Compound Sorafenib | US11505527, Compound Sorafenib | US9029401, Sorafenib | US9469639, Sorafenib | US9902709, Comparative example 1 | Xarelto | cid_216239 |
Type | Small organic molecule |
Emp. Form. | C21H16ClF3N4O3 |
Mol. Mass. | 464.825 |
SMILES | CNC(=O)c1cc(Oc2ccc(NC(=O)Nc3ccc(Cl)c(c3)C(F)(F)F)cc2)ccn1 |
Structure |
|