Reaction Details |
| Report a problem with these data |
Target | Cyclin-dependent kinase 3 |
---|
Ligand | BDBM4814 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_655715 (CHEMBL1244759) |
---|
Kd | >10000±n/a nM |
---|
Citation | Zarrinkar, PP; Gunawardane, RN; Cramer, MD; Gardner, MF; Brigham, D; Belli, B; Karaman, MW; Pratz, KW; Pallares, G; Chao, Q; Sprankle, KG; Patel, HK; Levis, M; Armstrong, RC; James, J; Bhagwat, SS AC220 is a uniquely potent and selective inhibitor of FLT3 for the treatment of acute myeloid leukemia (AML). Blood114:2984-92 (2009) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Cyclin-dependent kinase 3 |
---|
Name: | Cyclin-dependent kinase 3 |
Synonyms: | CDK3 | CDK3/Cyclin E | CDK3_HUMAN | CDKN3 | Cyclin-dependent kinase 3 | Cyclin-dependent kinase 3 (CDK3) |
Type: | Enzyme |
Mol. Mass.: | 35053.88 |
Organism: | Homo sapiens (Human) |
Description: | Q00526 |
Residue: | 305 |
Sequence: | MDMFQKVEKIGEGTYGVVYKAKNRETGQLVALKKIRLDLEMEGVPSTAIREISLLKELKH
PNIVRLLDVVHNERKLYLVFEFLSQDLKKYMDSTPGSELPLHLIKSYLFQLLQGVSFCHS
HRVIHRDLKPQNLLINELGAIKLADFGLARAFGVPLRTYTHEVVTLWYRAPEILLGSKFY
TTAVDIWSIGCIFAEMVTRKALFPGDSEIDQLFRIFRMLGTPSEDTWPGVTQLPDYKGSF
PKWTRKGLEEIVPNLEPEGRDLLMQLLQYDPSQRITAKTALAHPYFSSPEPSPAARQYVL
QRFRH
|
|
|
BDBM4814 |
---|
n/a |
---|
Name | BDBM4814 |
Synonyms: | CHEMBL535 | N-[2-(diethylamino)ethyl]-5-[(Z)-(5-fluoro-2-oxo-1,2-dihydro-3H-indol-3-ylidene)methyl]-2,4-dimethyl-1H-pyrrole-3-carboxamide | N-[2-(diethylamino)ethyl]-5-{[(3Z)-5-fluoro-2-oxo-2,3-dihydro-1H-indol-3-ylidene]methyl}-2,4-dimethyl-1H-pyrrole-3-carboxamide | SU11248 | SUNITINIB | SUNITINIB MALATE | US10464902, Sunitinib | US9163010, Sunitinib | US9914707, SU11248 |
Type | Small organic molecule |
Emp. Form. | C22H27FN4O2 |
Mol. Mass. | 398.4738 |
SMILES | CCN(CC)CCNC(=O)c1c(C)[nH]c(\C=C2/C(=O)Nc3ccc(F)cc23)c1C |
Structure |
|