Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetEnoyl-acyl carrier reductase
LigandBDBM50326330
Substrate/Competitorn/a
Meas. Tech.ChEMBL_657369
IC50>20000±n/a nM
Citation Tipparaju SKMuench SPMui EJRuzheinikov SNLu JZHutson SLKirisits MJPrigge STRoberts CWHenriquez FLKozikowski APRice DWMcLeod RL Identification and development of novel inhibitors of Toxoplasma gondii enoyl reductase. J Med Chem 53:6287-300 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Enoyl-acyl carrier reductase
Name:Enoyl-acyl carrier reductase
Synonyms:Enoyl-acyl carrier reductase (ENR) | Enoyl-acyl carrier reductase, putative
Type:PROTEIN
Mol. Mass.:43663.67
Organism:Toxoplasma gondii
Description:ChEMBL_1290812
Residue:417
Sequence:
MVGFKLLTLGAFVAGELTLVGPAGTMAFTVPNATGAKPLVTSVSVRPSWSSARQNAFSSS
SSRSQSSVRPHSAFVTNRLETAGETGTQHRAADSAAGVGAAQSAFPIDLRGQTAFVAGVA
DSHGYGWAIAKHLASAGARVALGTWPPVLGLFQKSLQSGRLDEDRKLPDGSLIEFAGVYP
LDAAFDKPEDVPQDIKDNKRYAGVDGYTIKEVAVKVKQDLGNIDILVHSLANGPEVTKPL
LETSRKGYLAASSNSAYSFVSLLQHFGPIMNEGGSAVTLSYLAAERVVPGYGGGMSSAKA
ALESDTRTLAWEAGQKYGVRVNAISAGPLKSRAASAIGKSGEKSFIDYAIDYSYNNAPLR
RDLHSDDVGGAALFLLSPLARAVSGVTLYVDNGLHAMGQAVDSRSMPPLQRATQEIN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50326330
n/a
NameBDBM50326330
Synonyms:5-chloro-2-phenoxyaniline | CHEMBL1240673
TypeSmall organic molecule
Emp. Form.C12H10ClNO
Mol. Mass.219.667
SMILESNc1cc(Cl)ccc1Oc1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: