Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetNADPH oxidase 4
LigandBDBM50326490
Substrate/Competitorn/a
Meas. Tech.ChEMBL_658093
IC50 1000±n/a nM
Citation Borbély GSzabadkai IHorváth ZMarkó PVarga ZBreza NBaska FVántus THuszár MGeiszt MHunyady LBuday LOrfi LKéri G Small-molecule inhibitors of NADPH oxidase 4. J Med Chem 53:6758-62 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
NADPH oxidase 4
Name:NADPH oxidase 4
Synonyms:KOX-1 | Kidney oxidase-1 | Kidney superoxide-producing NADPH oxidase | NOX4 | RENOX | Renal NAD(P)H-oxidase
Type:PROTEIN
Mol. Mass.:66954.54
Organism:Homo sapiens (Human)
Description:ChEMBL_792879
Residue:578
Sequence:
MAVSWRSWLANEGVKHLCLFIWLSMNVLLFWKTFLLYNQGPEYHYLHQMLGLGLCLSRAS
ASVLNLNCSLILLPMCRTLLAYLRGSQKVPSRRTRRLLDKSRTFHITCGVTICIFSGVHV
AAHLVNALNFSVNYSEDFVELNAARYRDEDPRKLLFTTVPGLTGVCMVVVLFLMITASTY
AIRVSNYDIFWYTHNLFFVFYMLLTLHVSGGLLKYQTNLDTHPPGCISLNRTSSQNISLP
EYFSEHFHEPFPEGFSKPAEFTQHKFVKICMEEPRFQANFPQTWLWISGPLCLYCAERLY
RYIRSNKPVTIISVMSHPSDVMEIRMVKENFKARPGQYITLHCPSVSALENHPFTLTMCP
TETKATFGVHLKIVGDWTERFRDLLLPPSSQDSEILPFIQSRNYPKLYIDGPFGSPFEES
LNYEVSLCVAGGIGVTPFASILNTLLDDWKPYKLRRLYFIWVCRDIQSFRWFADLLCMLH
NKFWQENRPDYVNIQLYLSQTDGIQKIIGEKYHALNSRLFIGRPRWKLLFDEIAKYNRGK
TVGVFCCGPNSLSKTLHKLSNQNNSYGTRFEYNKESFS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50326490
n/a
NameBDBM50326490
Synonyms:1,1-diallyl-3-(5-hydroxy-4,6-dimethyl-2-oxoindolin-3-ylidene)thiourea | CHEMBL1243064
TypeSmall organic molecule
Emp. Form.C17H19N3O2S
Mol. Mass.329.417
SMILESCc1cc2NC(=O)C(=NC(=S)N(CC=C)CC=C)c2c(C)c1O |w:8.8|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: