| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Adenosine receptor A3 |
|---|
| Ligand | BDBM50318666 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_658522 (CHEMBL1247724) |
|---|
| IC50 | 8300±n/a nM |
|---|
| Citation |  Rottmann, M; McNamara, C; Yeung, BK; Lee, MC; Zou, B; Russell, B; Seitz, P; Plouffe, DM; Dharia, NV; Tan, J; Cohen, SB; Spencer, KR; González-Páez, GE; Lakshminarayana, SB; Goh, A; Suwanarusk, R; Jegla, T; Schmitt, EK; Beck, HP; Brun, R; Nosten, F; Renia, L; Dartois, V; Keller, TH; Fidock, DA; Winzeler, EA; Diagana, TT Spiroindolones, a potent compound class for the treatment of malaria. Science329:1175-80 (2010) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Adenosine receptor A3 |
|---|
| Name: | Adenosine receptor A3 |
|---|
| Synonyms: | A3 adenosine receptor (hA3) | AA3R_HUMAN | ADORA3 | Adenosine A3 receptor (A3AR) |
|---|
| Type: | G Protein-Coupled Receptor (GPCR) |
|---|
| Mol. Mass.: | 36197.32 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P0DMS8 |
|---|
| Residue: | 318 |
|---|
| Sequence: | MPNNSTALSLANVTYITMEIFIGLCAIVGNVLVICVVKLNPSLQTTTFYFIVSLALADIA
VGVLVMPLAIVVSLGITIHFYSCLFMTCLLLIFTHASIMSLLAIAVDRYLRVKLTVRYKR
VTTHRRIWLALGLCWLVSFLVGLTPMFGWNMKLTSEYHRNVTFLSCQFVSVMRMDYMVYF
SFLTWIFIPLVVMCAIYLDIFYIIRNKLSLNLSNSKETGAFYGREFKTAKSLFLVLFLFA
LSWLPLSIINCIIYFNGEVPQLVLYMGILLSHANSMMNPIVYAYKIKKFKETYLLILKAC
VVCHPSDSLDTSIEKNSE
|
|
|
|---|
| BDBM50318666 |
|---|
| n/a |
|---|
| Name | BDBM50318666 |
|---|
| Synonyms: | (1R,3S)-5',7-Dichloro-6-fluoro-3-methyl-2,3,4,9-tetrahydrospiro-[beta-carboline-1,3'-indol]-2'(1'H)-one | CHEMBL1082723 | NITD609 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C19H14Cl2FN3O |
|---|
| Mol. Mass. | 390.238 |
|---|
| SMILES | C[C@H]1Cc2c([nH]c3cc(Cl)c(F)cc23)[C@@]2(N1)C(=O)Nc1ccc(Cl)cc21 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
